SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17229585|ref|NP_486133.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17229585|ref|NP_486133.1|
Domain Number 1 Region: 218-263
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0000602
Family Di-heme elbow motif 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|17229585|ref|NP_486133.1|
Sequence length 287
Comment hypothetical protein alr2093 [Nostoc sp. PCC 7120]
Sequence
MNYRQLFSDRLAVLATMHQKERVIAPLLERELGIKVIVPPDFNTDIFGTFTREVKRPGTQ
IAAARLKAEKALELTGENLVIASEGSFAPHPLVPYIYANREIIILLDKINAIEIIGEDFS
TDTNFNHQTVESLDEAYTFAKKIGFPEHGLVVCFENSEKKCHEIIKGITQETAFIEAINF
GLKKSPNSKINIETDMRAVYNPTRMKNIEKATHNLLQKISSCCPQCHTPGFETTERIKGL
PCELCHMPTTLTLTAIYQCKKCGFRQDKPFPNGIEFADPSQCLYCNP
Download sequence
Identical sequences A0A1Z4KFI5 Q8YV88
WP_010996251.1.33676 gi|17229585|ref|NP_486133.1| 103690.alr2093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]