SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17229663|ref|NP_486211.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17229663|ref|NP_486211.1|
Domain Number 1 Region: 23-343
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.76e-35
Family Filamentous hemagglutinin FhaB, secretion domain 0.01
Further Details:      
 
Domain Number 2 Region: 365-459
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000345
Family Filamentous hemagglutinin FhaB, secretion domain 0.068
Further Details:      
 
Weak hits

Sequence:  gi|17229663|ref|NP_486211.1|
Domain Number - Region: 437-577
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00173
Family Filamentous hemagglutinin FhaB, secretion domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|17229663|ref|NP_486211.1|
Sequence length 814
Comment hypothetical protein all2171 [Nostoc sp. PCC 7120]
Sequence
MKNMAKFKFLIGNISISLCLLNFTAAKAEIIPDDTLPTNSIVRPVGNIRVIEGGTQRGEN
LFHSFREFSFSVLTSNVTGNVAIFNHNLAVRNIITRITGGSHSYIDGLITAASGSRANLF
LINPQGIIFGANASLNIGGSFVATTANSIKFADGLEFNATTNNNTSLLTVNVPVGLQFGD
SPGNIEQPIVADLPLGLQVGNGRTLGLIGGNLLLESSLLEAPGGRVELGSVTGGGFVSLS
QVDDAYAAGYSGVQNFGDIRLAAGTLVNTGSIPMQDSGGAIQIQGRNVTIDDSLVFAVNF
GLQTGNSLIVNATESLKVGGISNILTIAQSQAKAGDIWITAKDSVELGEESFIGSQVCSL
GESCANVTGNGGNLTIETRRLLLTDGAGIEASTFGAGNTGNILVRATDSIDLRGESADGD
IPSGIFAQVAPDAPENAGNTGTITLETQQLNIQGGAQISNVSRYGSQGGDLLINASAGMQ
VSGTSQFATASSLDIFRSGIFAVTQAGTTTNDSTLNINTGLLTVENGARITADNLNIVGD
RLIIQNGAEVTVAGESGNLSIKARSLKLDNQSQLIAQTTSGNGGNINLNLSAILRLRLNS
QISTFADGNGGNIEINSPFIVATPNENNDITANVFGGAGGRVTISTQKFLGLVVRNRGEL
EQILGTTDPNQLDSGFLLTNDILTFSQASPSFTSMVTINQPDVDSRQRFAAFSTNPINTS
RLTQVCSSDGETEPGLKATFPGDRETKNSPSPHHLLTISNFTPINVVDNPDSPKIVEAQG
WVMDTNGNIALVAPVPTVNHQHPWFSSTICHIHE
Download sequence
Identical sequences Q8YV10
gi|17229663|ref|NP_486211.1| 103690.all2171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]