SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17229911|ref|NP_486459.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|17229911|ref|NP_486459.1|
Domain Number - Region: 14-64
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0272
Family Cytochrome c3-like 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|17229911|ref|NP_486459.1|
Sequence length 149
Comment hypothetical protein all2419 [Nostoc sp. PCC 7120]
Sequence
MASRKISDAIQQQIRQRASELCEYCHASEKWQYVLFTVDHIIPLSQNGEDTIENLALACF
HCNRRKSAKTTALDPESGLEVPLFNPRQSLWSEHFIWSADKLKINGLTPTGKATIAALNL
NRERIVNIRAADKVVNRYPPPEDPIEEIS
Download sequence
Identical sequences A0A1Z4KGF3 Q8YUD3
103690.all2419 NsR217 gi|17229911|ref|NP_486459.1| WP_010996575.1.33676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]