SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17229994|ref|NP_486542.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17229994|ref|NP_486542.1|
Domain Number 1 Region: 12-342
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.7e-51
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Domain Number 2 Region: 365-595
Classification Level Classification E-value
Superfamily Pectin lyase-like 8.08e-41
Family Pectin methylesterase 0.0097
Further Details:      
 
Domain Number 3 Region: 571-680
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000000017
Family Pectate lyase-like 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|17229994|ref|NP_486542.1|
Sequence length 682
Comment serine/threonine kinase [Nostoc sp. PCC 7120]
Sequence
MSLCINPQCSKPQNPDNVLFCQTCGSELLLEGRYRVVSVLGGGGFGKTFAVNDTRTQTAR
VLKVLINNHPKAVELFQREAQVLALLNYPGIPTVEANGYFVYFPRNIQEPMHCLIMEKIE
GLDLGEYLRQRDYRPIDEKLALQWFKEVVTILHQVHQQGLFHRDIKPSNIMLRADGRLVL
IDFGTARSVTGTYIAKQAVGQVTGVISAGYTPSEQINGQAVQQSDFFALGRTFIYLLTGK
EPSDPTIYNYLKDELHWRDGLLSSESNSVPPTVGYGVPPTVGDRTNILPQFADLLDQMME
RLPGQRPQNTHIILQRLADIEKNLHPSSPPPPKPKGWTRRRLITVVGFSSLGLTGALAIS
RLLPKTTVIVSQEGGGDYKTIGAAMQNAQPGMRILVRPGLYQESLVLDKALKIIGDGAKA
EIIIESKGASCLVVKTDQAEIRGLTFRSRAGTENKQYFAVDISQGQIILADCDITSDSLS
GIGIHGATANPVIQKCQIHDGKQSGIYLYENSRGTIEDCDLFGNTTTEITVDAAQPIIRR
CKIRQDKEGGILFRNQAQGTVEDCDIFNNNLSGIEIRDSSNPIIQKCRIHDNQQGDGILV
HLNGRGTVEDCNIFGNGFSGVEIRDRGNPVIRRCNINKNKYYGVYAYKNSMGTVENCDLT
GNIRSAINVDETSQLQRSGNVE
Download sequence
Identical sequences A0A1Z4KGN2 Q8YU54
103690.alr2502 gi|17229994|ref|NP_486542.1| WP_010996658.1.33676 NsR470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]