SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17230285|ref|NP_486833.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17230285|ref|NP_486833.1|
Domain Number 1 Region: 496-641
Classification Level Classification E-value
Superfamily beta-Roll 4.36e-17
Family Serralysin-like metalloprotease, C-terminal domain 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|17230285|ref|NP_486833.1|
Sequence length 681
Comment hypothetical protein all2793 [Nostoc sp. PCC 7120]
Sequence
MATFTVTTLNDVVNPNDGLLSLREAVTAAEALPGTDTIAINGIALLNSPVVIRQGNSINF
QGNGTSFTGFNGQGRTSLFLIDNSTVTFNNLQINRGLAQGGNGSRGGGGGLGAGGGLFLN
PGANVTADNVVFFDNRAVGGNSFTGRGDGGRGGNDSSAGSNGFPGGSGGLPSFFAIGGIV
PTSGGNGGAAGRIVGSTGLGAGGGVSGSSGGFGVGGGSGGGGGGGAGGAGAFRNATGGGG
GGFGGYGGGGGGGGGGGGGGANVLGGQARPGGAGGLGGAAGAFAGAGRDGANGGNGRSTF
NGNSPGNGGVGGQGGGGAGLGGAVFVSNSATFNVRNSSFLFNSAVGGSGFQNGQGRGGAI
FVQSGGLLRDMGGVRFIQNSASTANPDSNIYPVKVNRGDRTIEVEGFQGVGRGSNPSLEV
RETFDELIFTGEGLVAKNLLLTQTGDDLVVSFEGVDDTQVILKDFALENLDNLPIPGGQH
GQIGNIMFDGDETLQDSFDVFDADSTQNRIWNRNTVTFLNDLDNHVRGFDNSDDVINGQG
GNDIIGGLSGDDILRGGEGNDILYAGTGTDILVGGLGNDTLYLGSDRHIDTVIYRQGDGS
DVIHQFQRGAGGDLLQFEGIEAIDVVVHGRNTYFHLGDGVTGNTGFGSGELLAELRGVGG
FTSDNIGLNLASGNTAQFLFA
Download sequence
Identical sequences Q8YTC9
103690.all2793 gi|17230285|ref|NP_486833.1| WP_010996944.1.33676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]