SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17230500|ref|NP_487048.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|17230500|ref|NP_487048.1|
Domain Number - Region: 17-24,57-108
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00234
Family Di-heme elbow motif 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|17230500|ref|NP_487048.1|
Sequence length 120
Comment hypothetical protein alr3008 [Nostoc sp. PCC 7120]
Sequence
MMMMMTESMTAEMQACMKACMDCHKMCMETMTYCMSKGGMQMDMSMMGMMRDCSEMCMMC
VNMMMGGSEFMGRTCMLCAEMCDRTAMACEQMSGDQMMMDCAMACRKCAEACRSMQMMPA
Download sequence
Identical sequences A0A1Z4KID6 Q8YSS6
NsR173 103690.alr3008 WP_010997159.1.33676 gi|17230500|ref|NP_487048.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]