SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17230774|ref|NP_487322.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17230774|ref|NP_487322.1|
Domain Number 1 Region: 13-147
Classification Level Classification E-value
Superfamily Gamma-glutamyl cyclotransferase-like 2.35e-28
Family Gamma-glutamyl cyclotransferase-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|17230774|ref|NP_487322.1|
Sequence length 155
Comment hypothetical protein all3282 [Nostoc sp. PCC 7120]
Sequence
MTQLKTKFSGGVRIFVYGTLKPGEENYQRYCAGKVVLAQKATTLGQLFALPIGYPAMTIG
ESTVHGYLLSFADLGILDALDELEDYQPEGEMSENLYNRLEVEVKNPLGLSLGWAWVYLM
NPAKVEMLKGVHLPDGWWNSDNKSHHQTADYVLDD
Download sequence
Identical sequences A0A1Z4KIV3 Q8YS10
gi|17230774|ref|NP_487322.1| WP_010997433.1.33676 103690.all3282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]