SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17230838|ref|NP_487386.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17230838|ref|NP_487386.1|
Domain Number 1 Region: 1046-1153
Classification Level Classification E-value
Superfamily CalX-like 1.96e-30
Family CalX-beta domain 0.00058
Further Details:      
 
Domain Number 2 Region: 1217-1403
Classification Level Classification E-value
Superfamily beta-Roll 2.09e-25
Family Serralysin-like metalloprotease, C-terminal domain 0.00015
Further Details:      
 
Domain Number 3 Region: 118-263
Classification Level Classification E-value
Superfamily beta-Roll 1.01e-23
Family Serralysin-like metalloprotease, C-terminal domain 0.00072
Further Details:      
 
Domain Number 4 Region: 257-402
Classification Level Classification E-value
Superfamily beta-Roll 4.19e-23
Family Serralysin-like metalloprotease, C-terminal domain 0.0008
Further Details:      
 
Domain Number 5 Region: 535-680
Classification Level Classification E-value
Superfamily beta-Roll 1.83e-22
Family Serralysin-like metalloprotease, C-terminal domain 0.00088
Further Details:      
 
Domain Number 6 Region: 405-535
Classification Level Classification E-value
Superfamily beta-Roll 2.22e-22
Family Serralysin-like metalloprotease, C-terminal domain 0.00086
Further Details:      
 
Domain Number 7 Region: 798-925
Classification Level Classification E-value
Superfamily CalX-like 1.01e-19
Family CalX-beta domain 0.0036
Further Details:      
 
Domain Number 8 Region: 3-118
Classification Level Classification E-value
Superfamily beta-Roll 3.79e-19
Family Serralysin-like metalloprotease, C-terminal domain 0.00092
Further Details:      
 
Domain Number 9 Region: 915-1036
Classification Level Classification E-value
Superfamily CalX-like 1.02e-18
Family CalX-beta domain 0.0034
Further Details:      
 
Domain Number 10 Region: 686-804
Classification Level Classification E-value
Superfamily beta-Roll 9.42e-18
Family Serralysin-like metalloprotease, C-terminal domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|17230838|ref|NP_487386.1|
Sequence length 1428
Comment hypothetical protein all3346 [Nostoc sp. PCC 7120]
Sequence
MVIRGTNNDDNLIGTTGNDIIEGLGGNDRFEGGRGNDTLTGGTGNDVFNLEQQQDNDVVT
DFVRGQDKIDLRNLNINDWATLQLLISNDGQDNALITTFFNGSQSQIKLLNINPNLLQAS
DFIFNTVNLNQTIDGTNFADQLFGGLGNDTLRGFNGNDVLFGEQGDDRFEGGRGNDTFYG
GAGNDVFNLEQQQDNDVVTDFVRGQDKIDLRNLNINDWATLQLLISNDGQDNALITTFFN
GSQSQIKLLNINPNLLQASDFIFNTVNLNQTIDGTNFADQLFGGLGNDTLRGFFGNDVLF
GEQGDDRFEGGRGNDTFYGGAGNDVFNLEQLQDNDVVTDFVRGQDKIDLRNLNINDWATL
QLLISNDGQNNALITTFFNGDQSQIKLLNINPNLLQASDFIFNTVNLNQTIDGTNSPDQL
FGGLGNDTLRGFFGNDVLFGEQGDDRFEGGRGNDTFYGGAGNDVFNLEQLQDNDVVTDFV
QGQDKIDIRNLNINDWATLQLLISNDGQDNALITTFFNGDQSQIKLLNINPNLLQASDFI
FNTVNLNQTIDGTNSPDQLFGGLGNDTLRGFFGNDVLFGEQGDDRFEGGRGNDTFYGGAG
NDVFNLEQLQDNDVVIDFVQGQDKIDIRSLNISDWATLQLLISNDGQNNALITTFFNGDQ
SQIKLNNINPNLLQASDFIFNTNTVNLNQTIDGTNSPDQLFGGLGNDTLRGFFGNDVLFG
EQGDDRFEGGAGNDTFYGGTGNDIAVYLGTRSQYQVTSNGGVFTVTDTVANRDGVDTLRE
VEQIQFSDQTITIGNTSPTITLAVSPASVTEDGTPNLIYTFTRTGSTTNALTVNYSVAGT
ATLNTDYAQTGAASFTATTGTITFAVGASTAILTINPTADTTVESNETVALTLASGTGYT
VGTTTAVTGTITNDDFPSITLAVSPASVTEDGTPNLIYTFTRTGSTTNALTINFGVAGTA
TLNTDYAQSGAASFTATTGTITFAAGASTAILTINPTADTTVESNETVALTLASGTGYTV
GTTTAVTGTITNDDTLPTGITINLSGSQTIVEGNSSPQNVTYTVTLSQASSQIITVQYAT
ANGTATAGSDYTSTTGTLTFNPGETSKVINIPILNDSVNEANETFTLRLTSPTNATLGTT
NTVTTTITDTLSASVTTTLPTNVENLTLTGTAAINGTGNAGNNILTGNSGNNILSGGAGN
DTYAFVANAALGTDTITETATGGIDTIDFNGSTATVRVNLGVTTSQTVNNNLKLILSANN
VIENATGGTGNDRLTGNALNNILAGGNGNDQLQGLAGNDTLWGGLGDDILTGGIGQDKYL
FQSSGVFSSSLGVDYISQFDVGQDQIVLSKATFNAVTNSAGQALTDFAVVSDDEFVNASS
ARIVYSQGSGSLFYNRDGNVLGTSTVFEFARLGNPDITLSSSDFSLIA
Download sequence
Identical sequences Q8YRU7
NsR127 WP_010997497.1.33676 103690.all3346 gi|17230838|ref|NP_487386.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]