SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17230871|ref|NP_487419.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17230871|ref|NP_487419.1|
Domain Number 1 Region: 109-230
Classification Level Classification E-value
Superfamily Cysteine proteinases 9.32e-36
Family NlpC/P60 0.00000119
Further Details:      
 
Domain Number 2 Region: 15-85
Classification Level Classification E-value
Superfamily Prokaryotic SH3-related domain 4.49e-24
Family Spr N-terminal domain-like 0.0000433
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|17230871|ref|NP_487419.1|
Sequence length 234
Comment hypothetical protein alr3379 [Nostoc sp. PCC 7120]
Sequence
MLSNLESSIQSPKLGEYQCLAALNLYDSPECTSLATQAAVGRHLRVTSNQQGAAVEVCLC
EDDYPGWLSLGDWGLLKPATVLYQAKSFSESEIKKLLPEAIAFTQKAMQQSNYYLWGGTV
GPNFDCSGLMQAAFVSAGIWLPRDAYQQEAFTQAITIDELTPGDLVFFGTPVKATHVGLY
LGDSHYIHSSGKAQGRDGIGIDILSEQGDVVSRSYYQQLRGAGRVVKSYEPQRH
Download sequence
Identical sequences A0A1Z4KJ41 Q8YRR4
WP_010997530.1.33676 gi|17230871|ref|NP_487419.1| 103690.alr3379 359457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]