SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17231151|ref|NP_487699.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17231151|ref|NP_487699.1|
Domain Number 1 Region: 341-572
Classification Level Classification E-value
Superfamily beta-Roll 5.86e-23
Family Serralysin-like metalloprotease, C-terminal domain 0.00048
Further Details:      
 
Domain Number 2 Region: 3-109
Classification Level Classification E-value
Superfamily beta-Roll 8.06e-21
Family Serralysin-like metalloprotease, C-terminal domain 0.0026
Further Details:      
 
Domain Number 3 Region: 91-256
Classification Level Classification E-value
Superfamily beta-Roll 0.00000000000000209
Family Serralysin-like metalloprotease, C-terminal domain 0.0015
Further Details:      
 
Domain Number 4 Region: 242-338
Classification Level Classification E-value
Superfamily beta-Roll 0.0000000371
Family Serralysin-like metalloprotease, C-terminal domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|17231151|ref|NP_487699.1|
Sequence length 589
Comment hypothetical protein alr3659 [Nostoc sp. PCC 7120]
Sequence
MTIIHGTNSNDYLYGGDESDTIKGFAGYDYLYGGLGDDYLYGGLDNDKLYGGLGNDKLYG
GEGNDNLNGEQGNNSLYGEAGDDTLDAGNSTGNNLLDGGEGNDEIYVYSSSGNNTLKGGV
GNDILDVRFSYGKNILDGGSGNDQLYARYSQGNNTLRGGSGDDYLGVDLSAGNNVLNGDD
GNDILDVSYQWKGKNIVSGGNGNDIFYAYGVQGANTLNGGSGDDSFYISSPSADTVVHPL
VTQTVDGGIGNDYLYIDYSTAIAGITSSFNTTTKQGLITADTNQVRYKNIERLNIIGTSH
DDIIVGGNSDDIIDGGSGGNDTLNGGAGNDILIIRDNSRSHNTVYGGAGNDSLYANGTAG
TNLLDGGDGNDYLSAKNNYSYFFNASQTLIGGAGDDTLDVSGSYGNNFLYGGAGNDFLYA
DYSVGLHRLDGGDGDDYLSAKSSSSRFIINTHILDGGAGNDILDVGSARAKNKLMGGTGD
DILIGGLNEDTFVFKNYHEGVDRIYNFDHLDRIQICAVGFGGDLSPDSLSVGQFTLGTVA
TTNDQRFIYDTSTGALYFDQDGNGSGFNQVKFAQLDGIPSLSVSNFVVV
Download sequence
Identical sequences A0A1Z4KJY7 Q8YR01
WP_010997803.1.33676 103690.alr3659 gi|17231151|ref|NP_487699.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]