SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17231336|ref|NP_487884.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17231336|ref|NP_487884.1|
Domain Number 1 Region: 33-326
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 3.01e-59
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|17231336|ref|NP_487884.1|
Sequence length 339
Comment hypothetical protein alr3844 [Nostoc sp. PCC 7120]
Sequence
MVIVKSWQKIFTLLVVLLLCIGCSKVPSTSYNPWAVVSLPTEAKLLDIAFTENPQHGFLV
GSSATLLETNDGGNNWQPLNLALDDDRYRFDSVSFAGKEGWIVGEPSLLLHTTDEGRSWS
RIPLSEKLPGNPIAIQALGTDIAEMATDVGAIYKTTDGGKNWKAQVEAAVGVVRNLERSV
DGKYVAVSAKGSFYSTWEAGQNAWVPHNRNSSRRVENMGFSQDGLWLLARGGQVQFSDPA
NPDEWLDAETPELATSWGLLDMAYRTPNEVWIGGGSGNLLVSTDGGKTWEKDRDVEEVAA
NFYKVVFLKPDQGFVIGDRGVLLKYQPEAAKTATTEPAA
Download sequence
Identical sequences A0A1Z4KKG9 Q8YQI3
103690.alr3844 gi|17231336|ref|NP_487884.1| WP_010997985.1.33676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]