SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17231859|ref|NP_488407.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|17231859|ref|NP_488407.1|
Domain Number - Region: 58-147
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0018
Family Galacturonase 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|17231859|ref|NP_488407.1|
Sequence length 188
Comment hypothetical protein all4367 [Nostoc sp. PCC 7120]
Sequence
MLKSISSVAMTLIGFSTSLMFPHIAVAEEISCQRRLGAITVDNVKVPQGKTCTLAGTTVK
GNIVVEGGATLKAIGAKVNGSIQAEGASLVDVNSNTTVGGSIQVKQGRAARVVSTSIDGD
LQLESNSRQIVANQNQIDGNLQVFQNTGGVMIRQNRVKGNLQCKENTPQPIGGDNIVQGS
KEDQCARL
Download sequence
Identical sequences A0A1Z4KLW2 Q8YP34
WP_010998504.1.33676 103690.all4367 gi|17231859|ref|NP_488407.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]