SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17231927|ref|NP_488475.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|17231927|ref|NP_488475.1|
Domain Number - Region: 357-404
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0167
Family Di-heme elbow motif 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|17231927|ref|NP_488475.1|
Sequence length 413
Comment hypothetical protein alr4435 [Nostoc sp. PCC 7120]
Sequence
MFARIRRLVNQFFSKSRKINNEPLNRVSLIVIILIDIFILVNVFTGLDDISRWHLSPSQA
YPCYFQWQTYRTQTNKDKDYEIIRQSLLDNISNLPSQKQTYQQNEVDRLGKVSSTCLQYG
EYIDKIKTPQNQQAIKGIDQRQAQISNLKQSNNRIRAQYDSTLLDKLAGQAPGQSINQVP
AEKAKQELDKNNVRISQLEKEISNLKNQLLTQTESKSFIAFLQNRGEFATVEQGYKQASF
WYPSIQLAFQSLFLLPLIFAALLVHQFSQRRGYGLIALISWHLLVIFFIPLVLKIFEFLQ
VGAIFQFFFDVISAVFGSLLFLVSYVYILLIPLIGFGIIKFFQKIVLNPKLQAVNRIQKS
RCVKCAKKIRANDAYCPHCGYYQYIECQNCHNLTYKHLPHCKHCGTLQDVGNS
Download sequence
Identical sequences A0A1Z4KM51 Q8YNX4
WP_010998570.1.33676 103690.alr4435 gi|17231927|ref|NP_488475.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]