SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17232596|ref|NP_489144.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17232596|ref|NP_489144.1|
Domain Number 1 Region: 38-371
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.48e-44
Family Filamentous hemagglutinin FhaB, secretion domain 0.014
Further Details:      
 
Domain Number 2 Region: 340-441
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000361
Family Filamentous hemagglutinin FhaB, secretion domain 0.094
Further Details:      
 
Weak hits

Sequence:  gi|17232596|ref|NP_489144.1|
Domain Number - Region: 537-672
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00135
Family Filamentous hemagglutinin FhaB, secretion domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|17232596|ref|NP_489144.1|
Sequence length 828
Comment hypothetical protein all5104 [Nostoc sp. PCC 7120]
Sequence
MKLTFVGFGVLSVICLSAVCNNSVHAQVTQDNTLNTSVTATTSVNGSNIYNITNGTRVGN
NLFHSFSQFSIPTSDSVLFDNPTSIQNIFSRVTGGNVSNIDGLIQTNGSANLFLLNPTGI
IFGSHASLNIGGSFVGTTAETITFADGSKFSSTDTNTSPLLTMNVPVGLQFGSNQGGITV
QGTGHNAQLSDSVQVSGLNLNSRGLQLQPGKTLALLGKDIALDGGLLSAPGGLIELGGVT
NGNVILNSTPQGFAFQYSQVPSFGNIQITQRALASTRDLNGESGGAIHIQGKRVSIRDGS
MILVQNRSQKTAGDIAVDASEFLEITGKSPDFQSSSSLVNESTALGAAGNIIINTPRLNI
DQGGYIYNRTFSTASGGNIIVNTDETRVNGFAVGDPSAFRAVSQILAASYAGGKGGNISV
STQKLSVLAGGNIAARPYGVGSGGDVTVKADTIEVNNTGTPTGFYFSLISTATFGSGNAG
NLAIDTRKLSVQAGGRVSASSIILGNAGVLNINASESIDVNGVKDANNPSYIGTAVRPFG
TFAQISRANAGNTTINTPVLNVTNGATVFVENSGLGTAGTLQINANVLKLDNNASILASK
KAGEGGNINLQLRDVLLMRRGSLINAEAGSNGNGGNININSPIVIGLENSDIIANAVQGK
GGNIQITTQGIIGLEYRNLLNPREVLSNDITASSQFSVSGTVQINNVGIDPNSGLIDLPT
NLSDSSQQIATGCSNTNNSSFVATGRGGVPQNPMQEVRSDRPWSDIRDISAFHKTPALQA
QILESPKVFVHATSWHRNAQGKIELFAAKSPTGVQPSFTCASLAKSEL
Download sequence
Identical sequences A0A1Z4KP93 Q8YM37
103690.all5104 NYSGXRC-6346b gi|17232596|ref|NP_489144.1| WP_010999230.1.33676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]