SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17232597|ref|NP_489145.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17232597|ref|NP_489145.1|
Domain Number 1 Region: 2-272
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.07e-31
Family Filamentous hemagglutinin FhaB, secretion domain 0.02
Further Details:      
 
Domain Number 2 Region: 317-430,461-490
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000000361
Family Filamentous hemagglutinin FhaB, secretion domain 0.094
Further Details:      
 
Weak hits

Sequence:  gi|17232597|ref|NP_489145.1|
Domain Number - Region: 493-586
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0628
Family Filamentous hemagglutinin FhaB, secretion domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|17232597|ref|NP_489145.1|
Sequence length 740
Comment hypothetical protein all5105 [Nostoc sp. PCC 7120]
Sequence
MTGGSVSNIDGLIQANGTANLFLLNPSGIIFGKDASLNIGGSFIGTTANSIKFADGTEFS
GVKTNTTPLLTMSVPIGLQFGGNPGTISVEGTGNNHILNGISPISGLTSTDGLQLSSGKT
LALVGGNLVLNGSFLSAPGGRIELGSVNQGDVNINVDSSAFTLSYPRDNYSFGDIQMSRR
AIASVRGIIPGAIQVQGKQISLQDGSLVVVQNLGSQTAGDITINATESLQVIGMSSNFQS
SSGIVNETLQAGAAGNIAIITPKLTIDRGAIMINRTYSSAPSGNVVVKANEVLVGGIQPG
NPSANPIFGVLMAATYGKGQSGDLLLSSDRLSIFGGGNVGTRSFLTGNGGNVKISADTVD
ISSLNTLPGSYLISLLSANTFGSGNAGNLQLNTRKLSIQDGGLVSVSTVNFGNAGNLTIN
ATESIDVNGIKDPQNPSYIGAIARPLTVFTTSGISNNSNSTAKAGNITINTPQLTVRNQG
QVFTQNQILGDAGTLRINANTLHLDNGGSLSASTKAGEGGNINLQLRDVLLMRQGSFINA
EAGSNGNGGNININSPNVIGLENSDIIANAVQGNGGNIDITTQGIIGLEFRNTLTPKDDL
TNDITASSQFNLNGNVEINNVGVDPNSGLIELPANLSDSSQQIASGCDVNQGSSFVATGR
GGIPQNPSQELRSDRTWSDIRDLSAYHTTQPVQAQTPKSPKFLLQATFWRRNAQGKIELV
AAKSPSQMQTALTCAAVAEN
Download sequence
Identical sequences Q8YM36
103690.all5105 gi|17232597|ref|NP_489145.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]