SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17232605|ref|NP_489153.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17232605|ref|NP_489153.1|
Domain Number 1 Region: 21-166,200-362
Classification Level Classification E-value
Superfamily Pectin lyase-like 6.91e-42
Family Filamentous hemagglutinin FhaB, secretion domain 0.0097
Further Details:      
 
Domain Number 2 Region: 365-512,542-572
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000000596
Family Filamentous hemagglutinin FhaB, secretion domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|17232605|ref|NP_489153.1|
Sequence length 816
Comment hypothetical protein all5113 [Nostoc sp. PCC 7120]
Sequence
MKLTFVGFGVLSVIWLSVVYNNSVHAQVSPDNTLNTSVTSTTSINGSNSYIINNGTRIGN
NLFHSFSQFSLPSGGSASFDNATDIQNIFSRVTSGNISNIDGDISAKGSANLFLLNPAGI
IFGQNASLNIGGSFIATTANSIKFADGTEFSTVQGADKPLLTMNAPVGLQMGSNSAAIKA
QGRGYTNSGFFIVPTPNSTELQVKPGKTLALVGGNLQIDGFILTAPEGRVELVSTNGTGQ
VDLIPNAQGYMLGYENGQIFGYIQLAEKSLINVSGVNSGSVRLQAGNIRLTDGSLILAQN
YGYLPGGEINLQASTGIDLIGTSSDGEVLSGVRSETYGIGAGGNIGIFTRKFTLQEGSGL
NNLTSGIAPGGNIEIDAKTVEISGFSQINPNRVTGISTLSFASGSAGDIFVNGDNLLISG
GASLSSVTFGSGSSGKISIRNQNTTVVGNSPSGFDSAITLATFAFGDNKDLILNTGKLQI
LDGGRIGSSTLFAGNGGNVSINASEAIAISGRNNNNNSAINSSAMRLNAQLRQSSDFPDM
LTADAGSLSITTPNLSLMDGATVTVTSEGTGNAGNLNITADIIQLKNQALIQAQTESGNG
GDIDLKVGSLLLMRDRSKMTTTAGSTGNGGNINISSPTIVGLENSDITANAVRGQGGNIN
ITTQGIIGLEYGSQLTPGNDITASSEFGVNGTVQVNTIGVDPNSGLVALPTNFTDSSQKI
ASGCAENSDSSFVTTGRGGTPQNPNQEVRSDRTWSDVRDISAYRNTGAVTAQIPESLVLV
QATGWRRNAHGKIEILAYKSLTQVQPPLTCAAAAQS
Download sequence
Identical sequences A0A1Z4KNZ7 Q8YM28
gi|17232605|ref|NP_489153.1| 103690.all5113 WP_010999239.1.33676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]