SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17232606|ref|NP_489154.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17232606|ref|NP_489154.1|
Domain Number 1 Region: 30-333,364-391
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.29e-37
Family Filamentous hemagglutinin FhaB, secretion domain 0.015
Further Details:      
 
Domain Number 2 Region: 396-521
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000132
Family Filamentous hemagglutinin FhaB, secretion domain 0.071
Further Details:      
 
Domain Number 3 Region: 541-674
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000135
Family iota-carrageenase 0.076
Further Details:      
 
Weak hits

Sequence:  gi|17232606|ref|NP_489154.1|
Domain Number - Region: 676-768
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00785
Family iota-carrageenase 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|17232606|ref|NP_489154.1|
Sequence length 918
Comment hypothetical protein all5114 [Nostoc sp. PCC 7120]
Sequence
MMRINYKESNLWFQLLLTALTTGLFTSTLSLPTLAQVTSDNTTNTTVNAIGDDFSILNGI
DKGNNLFHSFSNFSVPTGGKATFDLTNTPNITTIFSRVTGGNVSQIDGLIRTLSSNNPVS
LFLMNPNGIVFGPNASLNIGGSFVGTTASSIKFSDGTEFSATNSAALPLLTMSVPVGLQM
GSNAGAIQVQGSPIQVQGLPELGFGLFFVRLPTLSVIPNQTLALVGSQIDIDSASISAPD
GHIELWALQSGEIALDKETGWQLTSSPNTVNGGTITLQQTSFVTADGSNGGAINIWGRGL
TLKDGSNIGAKTFAGQGKGITIHTTEFIDLLGTIDFVNQPLFAGISTSVGNSLGLFVLPG
PPATGQAGNITIETGRLKMTNGAWLVSSTSGNNSRTGDITIHATDVDLLGYETLFGASAT
SIGNLLLSGSNNQSGQVTVDAQRIHLFNGGRISSSVLGGNGRGGEVTIRATESLEIQGAN
PVGIFSAVLASLESGTTGQGGRISIDTGNLILSNGGGITSEVVGSQVNFLGLFIPGANGT
AGDIEIRAKDIQVSEPMIDGYSQTITGIKASLGNGSTGSGGNLNLTADNLRVFNGGQITS
SADGNGAAGNVNLQVNNITVEGMSKPLTDGRILPSTITAASTTTSDAGSVNLVANRLNVL
NHGQISVSNTGGGNSGNLIVNANRIKLEQGGSLLSEVSVGDRGNISLAADVLLMRSGSKI
NTNATGTATGGNISIHAPIIIGLENSDITANAIEGAGGNIDIQTQGLFGLKFRPQATSES
DITASSQFGVSGTVQINNFGVDPNSGLIELPGNVTDSSQQIATGCSANTGSSFVATGRGG
IPQNPTQDMRSDRTWSDIRDISAFQNTPSIQAQIPAQPQIPVQATSWHRNAQGKVELVST
LSSTLHLSQLTCTAIVEN
Download sequence
Identical sequences Q8YM27
gi|17232606|ref|NP_489154.1| 103690.all5114 WP_010999240.1.33676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]