SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17233088|ref|NP_490178.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17233088|ref|NP_490178.1|
Domain Number 1 Region: 45-373
Classification Level Classification E-value
Superfamily Pectin lyase-like 4.08e-33
Family Filamentous hemagglutinin FhaB, secretion domain 0.0071
Further Details:      
 
Domain Number 2 Region: 698-795
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000027
Family Filamentous hemagglutinin FhaB, secretion domain 0.068
Further Details:      
 
Domain Number 3 Region: 599-697
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000471
Family Filamentous hemagglutinin FhaB, secretion domain 0.036
Further Details:      
 
Weak hits

Sequence:  gi|17233088|ref|NP_490178.1|
Domain Number - Region: 448-537
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000173
Family Filamentous hemagglutinin FhaB, secretion domain 0.068
Further Details:      
 
Domain Number - Region: 868-1015
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000534
Family Filamentous hemagglutinin FhaB, secretion domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|17233088|ref|NP_490178.1|
Sequence length 1205
Comment hypothetical protein all7072 [Nostoc sp. PCC 7120]
Sequence
MLQLTYVPIGGSKEKPMINQFYFQWWWRLGLFLGLTCTTNLKALAQVTADQTLGTQVTDI
GLYSVIQGGTTVGNTNLFHSFGSFNIPNGGAAIFLNDPNLTNIFARVTGGTPSDIQGLIY
AQGTTNLFLMNPNGIIFGRNAQLNVGGSFVATTANAIQFPGGAEFSLTSSVPSGNTLLSV
NPTAFLFNQIANQGANSIENRGSLQVSDNKSLILLGGNVAPTPDASGQILMDGGIIEALG
GRVEIGGLTAPGSVGLQVNDDNLSLAFPNGVARTDISLINNSNVATFVLGTEGDDIVFHA
HNFNLLNFSSLQTFLISNQGNPETKTSDISINATGIVTIAESSFIGNVSLGLGNSGNINI
VGQSLKLINSGWLIINSQQGNSGIINVIVDDTIALSGKNADFPSSLIFSDGGINIQARNL
SLADGSFINSVSIRNLLLADGVLTNPNNLFVGNSGEIKIQATDYISLNESSITARTIGEG
NAGNLSIITNRLSLDNNSSITSDTSGEGNAGNLSIITNRLNLDNNSIITSGSSGSGNGSN
LNINARDIFLNQSYISTTSLMGLGISNVGNAGNINIQTERITITNRGSISSSSGEPAPGQ
IIGSGGNINVTATDFIEIDPKGLINAKDATTGFVARTGSSSRAGDITLNTKNLIVRDGGQ
ITVDASNNLGGQAGNITINASDSVELISSNLNQGSLISTSVFAVNDNVVAVGKGGELTIN
TGKLLLIKGVISSGTDGQGNAGNIFIFSNDEVVIDNGWIDSNVGSSGVGNGGDINIQTPK
LTLINGGRISSSVFGALEDLPAVQGKGGRIRINATNAVNISGLNADGITSAILTETQKGA
FGQGGDIIVNTDYFRLADKATISSATGNSSNAGNVTINARVVEVLNGGVLVTGTMSSGKA
GDITINATDNITIFSNTGLTALLAGTTSSGGGGNISLFTTDFNLSATNSNLPYPIAVATS
SLGEGVAGDINIVATGNFNANNGLVSASSEQSGGGHININARNIRLRNNSDIRTDLSGGN
GKGGDISLTADIIIALEDSDILAFAPEGQGGDIRFNTRAVFSDSLYSPRQTTSDRNSLQS
LSNNNRSDINATGTVSGNIIGVPDISFIQNGLTELENNPIDTNALIANSCIARSPKQEGT
FIITGTGSLPHRPGEAAASSYPTGDVQSVTNNSAASSWKKGELIVEPQGVYRLANGDLVM
SRECL
Download sequence
Identical sequences Q8YL63
gi|17233088|ref|NP_490178.1| gi|17233088|ref|NP_490178.1|NC_003276 103690.all7072 WP_010999632.1.33676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]