SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17233144|ref|NP_490234.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17233144|ref|NP_490234.1|
Domain Number 1 Region: 2860-3072
Classification Level Classification E-value
Superfamily beta-Roll 2.88e-31
Family Serralysin-like metalloprotease, C-terminal domain 0.00037
Further Details:      
 
Domain Number 2 Region: 2270-2368
Classification Level Classification E-value
Superfamily Cadherin-like 4.89e-30
Family Dystroglycan, N-terminal domain 0.031
Further Details:      
 
Domain Number 3 Region: 2474-2574
Classification Level Classification E-value
Superfamily Cadherin-like 5.06e-29
Family Dystroglycan, N-terminal domain 0.039
Further Details:      
 
Domain Number 4 Region: 2373-2473
Classification Level Classification E-value
Superfamily Cadherin-like 2.09e-28
Family Dystroglycan, N-terminal domain 0.033
Further Details:      
 
Domain Number 5 Region: 2575-2675
Classification Level Classification E-value
Superfamily Cadherin-like 5.06e-27
Family Dystroglycan, N-terminal domain 0.013
Further Details:      
 
Domain Number 6 Region: 2676-2774
Classification Level Classification E-value
Superfamily Cadherin-like 1.22e-23
Family Dystroglycan, N-terminal domain 0.032
Further Details:      
 
Domain Number 7 Region: 1123-1383
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 9.42e-23
Family Tricorn protease N-terminal domain 0.011
Further Details:      
 
Domain Number 8 Region: 1582-1692
Classification Level Classification E-value
Superfamily beta-Roll 1.03e-20
Family Serralysin-like metalloprotease, C-terminal domain 0.0016
Further Details:      
 
Domain Number 9 Region: 846-989
Classification Level Classification E-value
Superfamily beta-Roll 4.06e-19
Family Serralysin-like metalloprotease, C-terminal domain 0.0016
Further Details:      
 
Domain Number 10 Region: 1696-1867
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 0.0000000000000115
Family Tricorn protease N-terminal domain 0.023
Further Details:      
 
Domain Number 11 Region: 1001-1062
Classification Level Classification E-value
Superfamily beta-Roll 0.00000000000419
Family Serralysin-like metalloprotease, C-terminal domain 0.0026
Further Details:      
 
Domain Number 12 Region: 2021-2116
Classification Level Classification E-value
Superfamily beta-Roll 0.00000000157
Family Serralysin-like metalloprotease, C-terminal domain 0.0025
Further Details:      
 
Domain Number 13 Region: 2756-2857
Classification Level Classification E-value
Superfamily beta-Roll 0.00000222
Family Serralysin-like metalloprotease, C-terminal domain 0.007
Further Details:      
 
Domain Number 14 Region: 1435-1512
Classification Level Classification E-value
Superfamily beta-Roll 0.0000453
Family Serralysin-like metalloprotease, C-terminal domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|17233144|ref|NP_490234.1|
Sequence length 3083
Comment hypothetical protein all7128 [Nostoc sp. PCC 7120]
Sequence
MKSANTSNNNFIVKSSLILEPAQLTALEQALCLAKGDLKNFANEPDFSQKMEVAFGEGVE
VEFLRTAWLTGNFGDFPEIEIRHAADIKGVNGAFTTATNKIYLSHEFISKYQGNVGVIAS
VLLEEFGHWVDSRINTKDAPGDEGAIFSTLVRGQQLTQTELQKLKLENDQALIGLDGQTV
EIERSGSYSGNNLNEVATGLDTLLSQLQAAVSAQVFGSSLPLLGTQLKHAPNSEVQFLNN
LRTTIQSSLSQVNTFTSSTIQQALFNALGNGGQNILKDINGNGIDINDIQITETADNLKF
SLNLGKAASGFITQLDSNIGIPGIGLSINGNANTQLGYDFKFNFGVNKTNGFYFDTSDEN
EINIKLGASLPGLNARGKLGFLELSATDAGTKFDGVFKIDLRDTDNQLRLTELTSVNYAN
LIDTKLSGEADINLKLNTGFNNSSVILPSLKTDFNLDWSFSNSSFKPGQSQNLGTLPNVA
FNNVQLDLGSFFNDLTRPIFGRIGKIIEPVNKVLNFLTTPIDLKITKFNLLDIVKAAGYI
DDSDKQFIEAIQAIGKLVDTPSSQLAINLGSFNFGNQDIRANNFSLENVNPNTNGSASAW
NDQVADGSSEKSYLDNLLSLPGLEIPVLTQPSQAFGLLLGKPDVNLFTYDLPDLEFTLKY
DQFFPIIYVFGINVAGTLTTAVDLKFGYDTKGLKDFSDSQKPTDIFNGFFIDDSGKPQIL
VSAAIEAAAEVNVAAASAGAGGGIIGTIGLNLKDPTPGDGKVRGNEFVQLLNNPIEMFDA
SGLVQAYLMAYAKVAGKVVKRIESPKVTLLGPYGKVSETPPQLHLATDIGGGNLRLNMGP
NAAAREIINTEDGAEVFTVFTTDGKLTVSAFNIPQTYSGVSKIIADGGTKNDTIEIKPDI
EISADLKGGAGEDLIYGGSGSDTIRGGADWDRLYGGDRDDFVYGDDGDDWLDGGAGADIL
NGGAGFDTASYTSATSAISINLVTQVSTGDAADDVFQSIEQIVGSRYDDTLIGDEDNNEF
DGGEGNDFISGGAGDDRLSPGWGDDVIDGGTGTDTLVIDYSSLPTQAVAWSELDPNTSDW
FVYVANAYGIGAPIKTDINVSGNYHATLSADGLTVAGSGILGSNGSGNQGLWVKKIHSSD
PAVRVIPNNQVYQPLLSEDGSKVVWSQGDSIWIANTNGTQVRQLTKLSINIGYGDGDYLA
TISEDGSTIAWLRSKRNDNKFTYTIFIANADGKNLRQINIPTGSGGVRELDLSADGSKIT
WSQDGGYGPGGVWVANTDGTNIRELSGNLYGYNINPSISADGSTVVWAGYQGAGYASTNL
YAATTDGSRFWVVPNTEEVGEFAQQSLAGDSRRVVFTKFNGSDYSLYVGDIDGIEPQILI
DASSPNIGIGRGHALSSYVDLGVRYNSFDPATGSGEIYTWGPSRIRYSNFERFDIIGTRY
GDELFGGNLDDSLMGGGGADTLKAGLGDDIYILDTQNAGGSQIEDAGGTDTLRLTTRNPG
ATNTPRITDADLSLAVPTTGIFGMRRAGTSLIIDLNKDGIAASKTDLTILNFFDTVGTGA
GTGFIETVANLAGAEILSKLQVGDDTISGSAADDFIDGWLSNDTLSGGAGNDTLWGQDGN
DFLNGEDGNDSLQGGNGNDTLTPGWGNDVVDGGAGTDVLVLDYSNLNTRAVAWRTLSGTS
GNYLQKFFIGNAYGLGTPLKIRETNSVSDKFALSADGTTYAYYTYINYNDPANGLWIKKI
DDSGGLVKIDEIATEIALSTDGEKIAWSDGWRVYVANTNGTEKIRINLNNINGYIYSLSL
SGDGSQVSWNNGNQLLVANTDGTNIREITQSSTKSFLSENGSQIIWAGYQGEKYGIWSAS
TSTSLPVVKSLVDGNLSLSSSDGIKAIWQDRYFLSVSSTNSTEIQQVAESYDFRVVGGSE
PVLAADGAKVAFIKAINADNQGYGSYGLYVADPYKTGQATLVTTVNRDETSNHGLYGSLA
LSSYVDIGVRYNSLDLATGSGEISTWGPSHVRYSNIERFDITGTRYGDELLGGNLDDKLT
GGGGADTLKAGLGNDTYILAAQTAGGSKIEDDGENDTLDLTDINLSLSTPTIGTAGIQRL
GTTLLIDLNQDGITTPESDLSIINFFNSSSAGTGFIEKVDNLSGTDILNKLFGNSANQAP
VTQANKVLTVAEDSVTTPLAIATPTDTDNDLLTITITAVPEASKGIIRLPDNTVVTVNTT
LTTQQLTSLVFVSVVNANGSAGSFSYTVSDGKGGTASQTITLEITAVNDAPTLANAIANQ
TATEDTAFTFTIPANTFTDVDAGDALTYSATLADGANLPNWLSFNPSTRTFIGTPTNNSV
GTVNIRVTATDNAGASVSDVFTLTVANSDTNDAPTLENAIANQTATEDSAFTFTIPANTF
ADVDAGDTLTYSATLADGADLLNWLNFNPSTRTFSGTPTNDEVGTINIKVTATDNAGASL
SDIFTLTVINTNDAPTVANAIANQTATEDTAFNFQIPADAFNDVDTGDTLTYTATLENGD
ELPSWLTFDAATRTFSGTPTNSEVDTLSIKVIATDKSQASASNVFTLTVLNTNDAPTLEN
AIADQTATEDSTFSFIIPVNTFADVDADDILAYSATLEEGAALPSWLTFNPTNRTFAGTP
INSEVGTLNIKVIATDKSSANVSDVFTLTVANTNDAPILANAIADQAVAANNTFTFTIPE
NTFSEVDTGDILSYSTTLENGDPLPSWLNFNTDTRTFSGNPTTNNAGILNIKVTASDNQG
TTVTDIFALTVTASNINPGNDTNNSLSGTSSADVLNGFGGDDYIEGLAGNDTIDGGIGRF
DRLFGGDGDDAITDPDGILGAHGGLGNDTINVTFAANWDNDSNPNNSPRSDGKITGGYGD
DNITVTMNNSKFFINMKGDEPVNNAQGGNDVITLLGSYQNAIVDLGGGDDTFIGGNGSDN
VSGGAGNDTIFGFGGNDNLTGNDGDDILVGGSGNDRLTGGSGKDIFSFSSLADGIDTITD
FSVADDKIRVNAAGFGSGLVAGNLDASQFVLGSSAQDGSDRFIYNQATGALLFDVDGIGA
NTAVQIATLSNKIAINSTSIVIV
Download sequence
Identical sequences A0A1Z4KUT2 Q8YL10
103690.all7128 gi|17233144|ref|NP_490234.1|NC_003276 WP_010999685.1.33676 NsR467 gi|17233144|ref|NP_490234.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]