SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17233320|ref|NP_490410.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17233320|ref|NP_490410.1|
Domain Number 1 Region: 3575-3896
Classification Level Classification E-value
Superfamily Subtilisin-like 3.27e-44
Family Subtilases 0.00014
Further Details:      
 
Domain Number 2 Region: 32-216
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.7e-37
Family Clostridium neurotoxins, the second last domain 0.058
Further Details:      
 
Domain Number 3 Region: 772-885
Classification Level Classification E-value
Superfamily CalX-like 1.27e-31
Family CalX-beta domain 0.00074
Further Details:      
 
Domain Number 4 Region: 313-426
Classification Level Classification E-value
Superfamily CalX-like 6.54e-30
Family CalX-beta domain 0.00095
Further Details:      
 
Domain Number 5 Region: 4767-4929
Classification Level Classification E-value
Superfamily beta-Roll 8.37e-29
Family Serralysin-like metalloprotease, C-terminal domain 0.00052
Further Details:      
 
Domain Number 6 Region: 501-708
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.75e-25
Family Leech intramolecular trans-sialidase, N-terminal domain 0.05
Further Details:      
 
Domain Number 7 Region: 3423-3553
Classification Level Classification E-value
Superfamily CalX-like 1.44e-23
Family CalX-beta domain 0.0021
Further Details:      
 
Domain Number 8 Region: 3957-4051
Classification Level Classification E-value
Superfamily Cadherin-like 2.2e-23
Family Cadherin 0.093
Further Details:      
 
Domain Number 9 Region: 4377-4489
Classification Level Classification E-value
Superfamily beta-Roll 8.06e-22
Family Serralysin-like metalloprotease, C-terminal domain 0.0008
Further Details:      
 
Domain Number 10 Region: 4514-4652
Classification Level Classification E-value
Superfamily beta-Roll 1.04e-21
Family Serralysin-like metalloprotease, C-terminal domain 0.00074
Further Details:      
 
Domain Number 11 Region: 4053-4149
Classification Level Classification E-value
Superfamily Cadherin-like 1.55e-20
Family Dystroglycan, N-terminal domain 0.063
Further Details:      
 
Domain Number 12 Region: 4247-4368
Classification Level Classification E-value
Superfamily beta-Roll 1.7e-18
Family Serralysin-like metalloprotease, C-terminal domain 0.0011
Further Details:      
 
Domain Number 13 Region: 428-502
Classification Level Classification E-value
Superfamily CalX-like 2.22e-18
Family CalX-beta domain 0.0016
Further Details:      
 
Domain Number 14 Region: 4628-4746
Classification Level Classification E-value
Superfamily beta-Roll 1.07e-17
Family Serralysin-like metalloprotease, C-terminal domain 0.00091
Further Details:      
 
Domain Number 15 Region: 3302-3392
Classification Level Classification E-value
Superfamily Hypothetical protein PA1324 2.35e-16
Family Hypothetical protein PA1324 0.01
Further Details:      
 
Domain Number 16 Region: 3990-4033,4150-4229
Classification Level Classification E-value
Superfamily beta-Roll 0.00000000000903
Family Serralysin-like metalloprotease, C-terminal domain 0.0016
Further Details:      
 
Domain Number 17 Region: 269-327
Classification Level Classification E-value
Superfamily CalX-like 0.0000000000119
Family CalX-beta domain 0.0081
Further Details:      
 
Domain Number 18 Region: 2-52
Classification Level Classification E-value
Superfamily CalX-like 0.000000000034
Family CalX-beta domain 0.004
Further Details:      
 
Domain Number 19 Region: 715-778
Classification Level Classification E-value
Superfamily CalX-like 0.000000000497
Family CalX-beta domain 0.0089
Further Details:      
 
Domain Number 20 Region: 987-1123
Classification Level Classification E-value
Superfamily CalX-like 0.0000000017
Family CalX-beta domain 0.012
Further Details:      
 
Domain Number 21 Region: 887-971
Classification Level Classification E-value
Superfamily CalX-like 0.000000379
Family CalX-beta domain 0.01
Further Details:      
 
Domain Number 22 Region: 1651-1718
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.00000392
Family Cna protein B-type domain 0.01
Further Details:      
 
Domain Number 23 Region: 1107-1179
Classification Level Classification E-value
Superfamily CalX-like 0.0000262
Family CalX-beta domain 0.013
Further Details:      
 
Weak hits

Sequence:  gi|17233320|ref|NP_490410.1|
Domain Number - Region: 3210-3313
Classification Level Classification E-value
Superfamily CalX-like 0.0068
Family CalX-beta domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|17233320|ref|NP_490410.1|
Sequence length 4936
Comment hypothetical protein alr7304, partial [Nostoc sp. PCC 7120]
Sequence
MTITRTGGASGAVSVTLTPTNGSAIAPDDYSNTPITVNFANGETSKTVNLTQVSKALSFD
GVNDYVNVGAKSGLEVSTDITIEAWINPTGSGSSTIEGGIIVNKEGEYEVARFSDGTIRW
AFANNNPTWLWINTSYVAPLNQWTHIAVTYELGVIKTYSNGVLVHTYNGSGNIGDFHANE
DDFRIGGRQIGNQLFQGSIDDVRIWNKARTQAEIQADLIRELTGKETGLIGYWNFNSING
TTVQDLTGNQNNGAVLEAQNVIGIVTTSLITDDSIYEPTETINLTLTNPTNGANLGTQKT
ATLNIVDNDAVAGIFQFNNVSYAINENGTLVTAVTLNRTGESDGAVSVTVNLSNGSAIAS
VDYDNTPITVNFANGETSKIVTIPIVNDNQFEPNETINLSLSNPTGGATVGTQNTAILTI
VNDDLPQPGTINFNINNYTVNENGTASINLVRTGGSDGEVSVTLTPSDGTATAGSDYNNL
PITVTFANGETSKTINLISQNQGLFFDGNDYVDNPANFSETKDTFTIELWANPTATRAST
PETSSGVNAFFNQKYAIFPKQGLGTLGTSNDVYAGISIGTNGVTISEHTLNYMPSVLVYN
TALSGWNHIALVYENKTPKLYINGQFIKAGLTSQYIVHPSSLFGGTSIRQEDWSFKGSID
DVRIWHKARTEEEIKAGLNRELTGNESGLIGYWNFNSINGNIVQDLSTNKNNGTFFGAQS
TAGFSTSFIINDNIYEPIETVNLTLTNPTGGATLGTQKTANLNIVDNDAIAGTIQFSNAN
YAVNENGTAVNAVTLNRTNGSDGVVSVRINLTNGTATAGSDYNNSPITVNFADGENSKTV
TIPIIDDSILESNESINLTLANPTNGATIGTQNSAVVNIIDNDLKPTLTVNITAEQLTEG
NTIQGTVTRNTDTTEPLTVTLVNSDNTQITVPTTVTIPAGANSVNFSITAVDDNLIELPR
NYSIIASAPGFISGSDSVGVIDNDAVTLSLTVDTTNINENGGKAIATITRNIVTDIPLVV
QLSTSDTTEATVPATVTIAANQASATFEIQGVDDTIVDGTQAVIITARPIYTNTNVAVPT
GNATANLNVVDNESPSLKLTIDRDLISETGTATAIITRNTNTDSALVVTLNSSDTTEATV
PNTVTIAAGQTSATFTITGVSDGINDSSQNVTITAAANGLNSGTDSLEITDINVPDLTIT
NLQGIQPTYTGKQSQFTYTVANNGIIAASGSWKDRVYLSRDNKLDASDTLLGGFALGSAE
NPANLLSGTSYDRTVTYFAPRTPGQYYLIASTDTDNTVNEGVGIGENNNTTITPVTVTPA
YRAIVSTDTETALAGNSVILRGQAISNSDNSPVAFEFVKVRVENKGTIREFDSFTDANGN
FVRQFNPLPGEAGTYNINAYFPAFAAEDNAAEDQFTLLGMRFEQNDQFLQQVTQKIVEGT
TFNGQVKLQNLSNVGLSGLTASIIDAPSNWIVEVTPQKTSLAGNEEITVNYNITVPDDSL
LYDQLQIRLNTTEGVTATLPVTVNVEQILPRLVADTSSLQASMLRGGQTLVEFTVTNQGG
IASGELDVLLPEASWLKLASPVEIPTLNPGESTKVSLLLQPSATQELTVYNGDLVIAGAE
TSLRLPFNFRAVSEAKGNLNINVVDELFFFAEGSPRLENATITLIDPFNGKVIFSQRDAD
GILSFTDLVEGYYTLRINADNHDSYQQNIYIGAGETENIQAFLSRQTVKYTWTVTPTEIE
DRYTISVQSTFETDVPIPVVTINPPLIDLKDLQVIGQIMQIDMTVTNHGLIAANDIKLNF
GSHPFYKIEPLINDVDILSAKSFLTVPIRITRIADFDTLPNGQSELSLASTPQVPCSISS
SIIYSYPCGDIDVQRSTTIVINNVEGNCGGGLPSIGIGGGGAGGAGGAGGGVFVYSSTPI
IYASNPCNTDPDNPPNEPDCNYPDMLDTFSDKYDDKRGTATAGYHHQVLCIAEKAAGNNW
GQGFVKKILCQMANDLKNGRGSTRELDYLTDLIPPWIPVSSPGVPTTGDIGSLGAGGFHF
IRDLLPGFTRAICNGSYNRSEHEGFFNQGVVPCFNEVAASGEMSQFAADIAQRVVPDGAD
LMVTYLTARKDDGTLNCSGFGSQSLIAETSPNLLPQNYQQIQPSSLTKDQLFSEELASSS
VLKIEIDDLFFLSVGEQFQLKVSKNNLDGTISDLTSSLTGTQYFVVADNQISQISTDGLL
SILSSSFPLVQFTPILYVIARNGDDFGIGQFAIQDSDNDGDGLADSYERKIGLDSNVSNN
KNSDLDGDRLNDFYEALIYSNPLVKDTDGDGVDDGIEEQNGRDPNNPDPKDNTQGVCAQV
KIQIDQEAVMTRAAFLGTLEIDNGNISNLENLSVTLQVKDAQGNIVNDLFGITNPVLKNI
TAVDGTGILIKDDPTTTVDEGIGSAQWTFIPTNLAAPETATQYSIGGTLSYKENGTTVTV
PLLSTPITVYPQAELYLDYFHQRDVFADDPFTNDIIETSVPYSLAVLVRNEGKGEAKNLK
ITSGQPKIVDNEKGLLIDFQIIGSEVNGTGVSPSLTVNFGNIAAGQTAVADWLLKSSLQG
KFIDYKATFEHINNLGKAELSLIKDVKIHELTRKVQINQPTDDGLPDFLVNDIFDANFTP
DTLYFSQGGTAPVNAITNATSDAPATLGDLSVQISTTVNAGWNYFRLADPSNAQFDIQKV
LRADGSEVKLDNVWTTDRTFPATGRPIYENILHFLDRNSTAGNTTYTVIYTPGGPSITDI
IDVSPDPRSTAVNAITVDFSEAVKADTFDISNITLTLDGGANLITSGVGIVAQSPTRFQI
IGLSNLTNLDGTYQLTVNAAGIADIGGKLGAGAVSETWIKTATGNADTTAPIVTDVVDLL
AKTRNQPVSSLNVTFSEKIDLSTFNWQDITLTRNGGANLITNAVTISAINDTTYRINGLS
GLTTTDGNYTLTANGSGIQDLSGNAGTGTQSETWVMDTVAPTVPSNISVTATPSPASLQT
TSASLGVLNQFGQIRVNSTSVTVTGDLGETGLRVSLIDKTTSQTLGQATVTGTSFSSNIQ
LLSPGNRDVDLQVQDVAGNITTTTLSLFADITKPTITDFLNVPQNSVTTPVNFIDVRFSE
QINLNTFDRNDITLSRNGENLTLPNTVTVEYLSGTTYRINGLSNFNTPGTYQLQVDATTV
QDNAGNSGDAARTTTFTIAAPPTPGVTITQSGGSTAVIEGGNTDSYTLVLRTQPTADVTV
TLNTGSQITTDKTTLTFTSANWNTPQTITVNAVNDTITEGNHTSTISHSISSTDTNYSNV
TLPDIAVSITDNDAEIRGMKWNDIDGDGVKDTGEPGLQGWTIYLDSNTNGQLDNGEISTT
TDANGNYQFTNLRPGVYTVAEVQQPGWKQTFPGTNITTTNADIPLAIPSLDMISPGDSNG
IQLNFSAANYIVKEDGTAITEVWVTRTGNTSSAVSATLSFTDGTATGCGCGASSVNNDFN
NVPFTIAFAENETSKLISVQNALLANPNAIKIRNDSKVEGNEYFTIKLTNPTGGAVIGNQ
SIATVTIIDDEAPSDITVTPPLETPSTTITSAVDSQAIYLINLNNFWADSRFANIKGNDF
TSVIIDTGIDLNHPFFGADTDNNGIADKIVYQYDFADNDADASDRNNHGSHIASIFSSVA
PNSDIIVLKVFKDNGAGSFADLEKALQWVAANSNTYNIASVNLSIGDSQNWTTATGRYGI
GDELSAIASNNIIINAAAGNSFYQYTSNPGLAYPAIDPNVIAVGAVWADNFGGPKNFVGG
AIDYTTTADQIASFSQRHPELLDIFAPGILITGANANGGTTTLGGTSQATAYLTGVATLA
QQIAQEKLGRKLTVTEFRNLLDTTSVIINDGDNENDNVTNTGFNYPRVDLLKLAEAILSL
TGTTPNPDPVNPGNNNNNNGTTTSDNTINQVHTVNLAAGQVRTDVDFGNQQIITNQAPTV
ANAIADQIINEDANFTFVIPANTFVDADAGDVLTYSTTLPSWLTFNATTRTFSGTPGNSN
VGTVNITVTATDSTGASVDDSFTLTVANTNDAPILGLAIADQSTASNTPFTFQIPLNTFS
DIDTGDTLTYSAKLVGDIPLPTWLTFNATNRTFSGIPGNVDVGTLNITVQAIDTSNASIS
DSFVLTITNLINNIVGTSGNNTLAGTPNNDNIQGLGGNDIIFGLAGNDTLNGGTGSDTMT
GGLGDDTYIVDNNVDKVVENLNEGIDTVRSSISYTLLENVENLILTGTSNISGTGNILSN
IITGNSGANTLNGKAGDDILNGEGGNDNLKGEDGNDVLNGGAGNDILDGGLGDDVMTGGV
GNDIYYVDSSNDIIIDELNEGTDTVNTIITWTLGNHLENLTLIGSSAINGTGNALKNIII
GNSADNILSGGDNDDILRGGEGNDTLYGGAGNDSLDGGIGNDSLNGEDGNDNLKGDVGND
ILNGNAGNDTLDGGLGDDVMTGGAGNDIYFVDSSNDTIIEELNEGTDTVNASINWTLGNN
LENLTLTGSNGINGTGNALKNIITGNNGDNILSGGDNDDTLRGNAGNDTLFGGSGNDSLS
GGIGDDILNGADGNDNLKGEAGNDTLDGGAGNDSLDGGLGDDVMTGGAGNDTYFVDSSND
TIAEETDGGSDTVNASVSWTLDDNLENLTLTGSNAINGTGNALRNTITGNSADNILSGGD
NDDTLRGNAGNDILNGGAGNDSLDGGLGDDVMTGGASNDTYFVDSSNDTIIEEADGGTDT
VRASITLTLGDHLENLILIGNSPIDGTGNALRNNITGNVANNILSGGADNDTIISGDGDD
TLYGDSGNDTLTGGNGNDILVGGMGSDRLTGGNGKDTFAFSAPITDGIDTITDFNPLDDL
LRVDAAGFGGGLVAGTLLASQFVLGTAAKTTSDRFIYNQSTGALFFDVDGTGSSSQVQIA
TLSNKPVINATNISVI
Download sequence
Identical sequences Q8YKJ3
103690.alr7304 NsR469 gi|17233320|ref|NP_490410.1|NC_003276 gi|17233320|ref|NP_490410.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]