SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17227580|ref|NP_484128.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17227580|ref|NP_484128.1|
Domain Number 1 Region: 2-117
Classification Level Classification E-value
Superfamily XisI-like 7.19e-39
Family XisI-like 0.000000614
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|17227580|ref|NP_484128.1|
Sequence length 125
Comment hypothetical protein alr0084 [Nostoc sp. PCC 7120]
Sequence
MDKLSYYRHTVQEIIKKYYDLSNSQLATATETKISDGVPDTVGDRMIIDEQRDQYLWLRC
GWDGKKRVQHIILYLQIQNGKIWIEEDSTDLAIVDEMLVAGIPQTDIILGFHHPSKRGLT
EFAIA
Download sequence
Identical sequences A0A1Z4KPX0 Q8Z0K7
WP_010994261.1.33676 103690.alr0084 gi|17227580|ref|NP_484128.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]