SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17227862|ref|NP_484410.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17227862|ref|NP_484410.1|
Domain Number 1 Region: 28-357
Classification Level Classification E-value
Superfamily Pectin lyase-like 9.1e-35
Family Filamentous hemagglutinin FhaB, secretion domain 0.0076
Further Details:      
 
Domain Number 2 Region: 626-746
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000957
Family Filamentous hemagglutinin FhaB, secretion domain 0.032
Further Details:      
 
Domain Number 3 Region: 364-493
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000314
Family iota-carrageenase 0.088
Further Details:      
 
Domain Number 4 Region: 815-911
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000408
Family Filamentous hemagglutinin FhaB, secretion domain 0.064
Further Details:      
 
Domain Number 5 Region: 494-619
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000722
Family Filamentous hemagglutinin FhaB, secretion domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|17227862|ref|NP_484410.1|
Sequence length 1152
Comment hypothetical protein alr0366 [Nostoc sp. PCC 7120]
Sequence
MIKQDYLNWYFTLSLLVSLTLTTNAKTLAQVTADQTLGTQVTDIGLSYFVQGGTTVGNTN
LFHSFGSFNVPNDGAAIFINDPSLTNIFARVTGGTVSDIQGRIGTQGTANLYLINPNGII
FGTNASLNIGGSFVATTANTIQFPGGAEFSLTSPVTSTNTLLSVNPTAFLFNQIANQGTN
SIENRGYLAVPNNKSLILLGGNIAPTSNATGKILIDGGVVQALNGRVEIGGLVEPGFIGI
NVDGNQLSLTFPDSVAKTDISSINNGTVFTSGAGGGDIVVNADNLSLLNYGAFFTGILNN
QGNAETQAGDISINATGIVTVAQNSIISNSSLGIGDSGKINIVAQSLQIIDNSSVQSFSL
QGNSGTVNVKVDDTVSLLSGQISSSVRPRGASASSLQSNLLGTPTRGKSGGINIQARSLL
AVDSSAISASNFLADDSGDIKIQATDAVILNNRSTISSSAFGQGKSGNLSINTNWLNIIN
NSQITANTLGTGNAGDINIIALDINIDKSLITGSTSSFLNTIVNLGNAGNINIQTARINL
TNSGFIISTSGRPEQKETSGFGGNINITATELIEIDPKGATDIITGFSTRTFSGSRAGDI
TLNTKNLIVRNGGVIMADAANNLGGNAGNININASDTVKLISSLGNSYSRIFTGVVSSDN
NVMNAGNGGELNITTGKLQLTNGVISAATLGQGHAGNITISSNDEIVLDSGLIFSQVDAG
AVGNGGDINIQTPRLTLTNGSQVDASIRRGGIGKGGTIRIDAADSVIISGRDADGFASLL
AAGNEGGSIGQPGDIIANTDYFLIEKDAFLNTGTFNSSNGGSVTINTRIFEALTGGRIFS
STSSSGKAGDIIINATDSITVSGVSPETRNNAAIVAGTLIDSTGNGGKISLSTTNFNLSN
EAGVFTRSQGRGIAGDINITARGNLNVNNAFISARAEQAGGGNIDIITKNVNLRNHSDIR
TDLSIGEGRGGNISLTADIIIALEDSDILAFAPEGQGGDIKFNTRAVFSDSLYNSRQTAS
DRNSLQSLVSNSSSDINATGTISGKIIGVPDISSIQNGLTELQANPIDTTVLIANSCIAR
SRRQEGTFIITGTGGLPTRPGEAVNSSYPTGDVQSVTHQSTASLWKKGDLIIEPQGVYKL
ANGDVVMSRECH
Download sequence
Identical sequences A0A1Z4KQT4 Q8YZU1
WP_010994542.1.33676 103690.alr0366 gi|17227862|ref|NP_484410.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]