SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17227863|ref|NP_484411.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17227863|ref|NP_484411.1|
Domain Number 1 Region: 25-356
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.01e-34
Family Filamentous hemagglutinin FhaB, secretion domain 0.009
Further Details:      
 
Domain Number 2 Region: 360-489
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000408
Family Filamentous hemagglutinin FhaB, secretion domain 0.062
Further Details:      
 
Domain Number 3 Region: 623-741
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000361
Family P22 tailspike protein 0.053
Further Details:      
 
Domain Number 4 Region: 486-614
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000104
Family Filamentous hemagglutinin FhaB, secretion domain 0.084
Further Details:      
 
Domain Number 5 Region: 811-897
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000377
Family Filamentous hemagglutinin FhaB, secretion domain 0.064
Further Details:      
 
Weak hits

Sequence:  gi|17227863|ref|NP_484411.1|
Domain Number - Region: 872-968
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00691
Family Filamentous hemagglutinin FhaB, secretion domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|17227863|ref|NP_484411.1|
Sequence length 1158
Comment hypothetical protein alr0367 [Nostoc sp. PCC 7120]
Sequence
MIKQKNFNWVFYLGLLFSVGVTTNNQTLAQVTADQTLGTQVVDINLNSFILGGATVDNTN
LFHSFGSFNVPSGGAAIFINDPSLTNIFARVTGGTASDIQGRIGTQGTANLYLINPNGII
FGTSARLNIGGSFVATTANAIQFPSSTEFSLTSPVTSTNTLLSVNPTAFLFNQIANQGTN
SIENRGSLIVPNNKSLILLGGNIAPTSNATGEILMDGGRLGALGGRVEIGGLAAPGSVGI
NTNGNSLSLSFPDSVARANTSLINNALILASGVGGGDIVVHANSLSLLNSSDFFAGILDN
QGSSQTQAGDIAINATGIVTVAENSIIGNSSLGIGDSGNINIVSQSLHIINGSVQAFSLQ
GNSGTVNIKVGDTVSLSESQISSIVRPKDSSLQSNFLGTPTRGKSGGINIQTRNLSVVDN
SIISASNILADDSGDIKIQANNSVILNNRATIFSSVFGQGNAGNLSIITNRLDIRNNSQI
ATTTFSNGNGGDININAHDISIDKSFISGGASSFRTDITNIGNAGTINIQTERISLTNRG
LITSISDEPAPEKTIGYGGNINITANELIEIDTKGTTGVITGLVARTFSGSRAGDINLNT
KNLIVRDGGYISVEAANNLGGNAGNITINASNSVELTSSIGNRPSIIFTGVSDFNDNAIA
VGNGGDLKISTQNLQLTNAAISAGTFGQGNAGNINIFSNDGVVIDNSVINSRIGAGAVGN
GGDIDIQTQRLTLTNGGGIDTVVSPPEGNLPGGQGKGGTIRINATDAVTISGTNANGFES
AILTETQGGAFGQSGDIIINTDYFRVVDNGSVSTLTGNSSDAGNILINTRVMEVLNGAAV
VTGTESIGKAGDITINATDKINILSNTDLHGNTGLLASTTSSGDAGNIYLFTTELNLLAP
NSNLPAPVLVATLSQGSGIAGNINIVATGNYNANNGLISARSEQAGGGNISVNARNINLR
NNSDIRTDLFSGSGKGGGISLTADIIIALEDSDILAFAPEGQGGDINFNTRAVFSDALYT
ARETIPDSNSLQSIVNNSRPDINATGTISGNIIGVPDISSIQNGLTDLQANPIDTTVLIA
NSCIARSPRQEGTFIITGTGGLPTRPGELKASNYPTGDVQSVSNNNVASAWKKGNAIVEP
QGVYRLANGDMVMSRECS
Download sequence
Identical sequences A0A1Z4KR15 Q8YZU0
103690.alr0367 WP_010994543.1.33676 gi|17227863|ref|NP_484411.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]