SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17228056|ref|NP_484604.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17228056|ref|NP_484604.1|
Domain Number 1 Region: 1-65
Classification Level Classification E-value
Superfamily XisI-like 1.31e-30
Family XisI-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|17228056|ref|NP_484604.1|
Sequence length 66
Comment hypothetical protein asl0560 [Nostoc sp. PCC 7120]
Sequence
MGWEGQDWIHSCIIHIDIKNGKIWLQWNGTEDDIAADLVTMGVPKEDIVLGFQSPFMRKF
TEYAVG
Download sequence
Identical sequences A0A1Z4KRE8 Q8YZB9
gi|17228056|ref|NP_484604.1| 103690.asl0560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]