SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17229398|ref|NP_485946.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17229398|ref|NP_485946.1|
Domain Number 1 Region: 35-271,310-411
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.32e-39
Family Filamentous hemagglutinin FhaB, secretion domain 0.0089
Further Details:      
 
Domain Number 2 Region: 418-548
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000148
Family Filamentous hemagglutinin FhaB, secretion domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|17229398|ref|NP_485946.1|
Sequence length 805
Comment hypothetical protein alr1906 [Nostoc sp. PCC 7120]
Sequence
MTQNGKGSSWQLNLAISLTSAGVIGISIASSVAQCAFAQSVIIPDQTLGNERSQVSENYN
NNPTEAVTGGSVRGNNLFHSFQEFNVNEGRSALFVAPNSSIQNIFVRVTGNNRSDIFGKL
ETSGVNANLFVINPNGIFFGPNATLNIGGSFVASTASGIQFGDRTIFSATSPQPLLTMSV
PIGLQFGRTGGEINVQGELAVPTGKTLALVGGNVTLDGGNVSFLRRRTIKAESGQIAMGG
ILGVGTVGINLNANNDINNQILSFSDDAVLADVFLNNQSRVDVSGQGAGYIEIQGKQIGL
SRASQVVADTEGSQSSRGIFIQAENLTLADGSQVTASVTGAESTASGGNVTVKATDSVRV
AGIVPNGLENAGFNTGLFTLTLGKGPGGNLTIEAGRLIVEDGGNISASTRGNDIRSVGGT
IKITASEFVKISGNTKDSRERPSGVFAQTSGAGNAGSLIINTPVLFVQNGAVISATTLAN
SQGNGGNITIKASDFIEISGSSPIGQFPSGLFARSRGSGNAGSILITTGQLNVRDRATVT
VDALGTGNAGRIEINAREIRLDGKANLNATTRSGNGGDINLQIDDQLLLRRASFISTRAG
TTSGSGNGGNILINIPNGFIVAVPGENSDITANAFKGQGGKVSINAFSVFGIEFREKENP
LTNDITASSEFGLNGTVEIDTPEVQPDQGLINLPTQPVESRLAQVCQAVAGQNQDSFIIT
GRGGLPNNPNELLYSDAVLTDWVSVSNVETIPNSPISKSISTPTQTNIVEATGWVISPQG
EVVLTVNTPNTKSPNSWQKTSTCNS
Download sequence
Identical sequences A0A1Z4KEY4 Q8YVR8
gi|17229398|ref|NP_485946.1| WP_010996070.1.33676 103690.alr1906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]