SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17231100|ref|NP_487648.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17231100|ref|NP_487648.1|
Domain Number 1 Region: 49-334
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.73e-40
Family Pectate transeliminase 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|17231100|ref|NP_487648.1|
Sequence length 552
Comment hypothetical protein alr3608 [Nostoc sp. PCC 7120]
Sequence
MKHQGFNFSSLRNLFSVLSLPTGITALLVASSGFMLVPSGVNASAAPTLTAQVPTTAPVI
YVNPTTGADTASGGTTAATPYKTITFALNQAQPGAIIQLAPGNYSSETGEQFPLILKPGV
TLQGDESTRGQGVLITGGGFYTSRTFARQDITILANNDTTIAGITATNPNQRGTAVWVES
SNPTIRNNTFTNSVREGVFVTGTGNPKIQGNIFIQNKGNGISVARSAQGEISNNLFQDTG
FGIAIGGTSTPLVAENQIVQNQDGLYISETAKPVLRKNVIQNNKRDGIVATVNAQPDLGT
SENPGGNLIRSNGRYDVNNATRTVRILAVGNDIDQKKIFGQVDFVAATVEPPPSGQGTAF
TDVATNYWAKGYIEALASQNIIAGFPDGTFRPNEPVTRAQFATIITKALTPQAKRNAINF
RDVSSNFWAFAAIQAAYRSQFVSGYPDGTFKPQQEIPRVQALVSLANGLGLTANNQNVIS
IYSDAGQIPGYAVGPVAAATTRQLVINYPTVSQLNPNRPATRAEIAAFVYQALVNAGRAQ
PLPSSYLVQVPQ
Download sequence
Identical sequences A0A1Z4KJU0 Q8YR42
103690.alr3608 NsR93 WP_010997757.1.33676 gi|17231100|ref|NP_487648.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]