SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17231137|ref|NP_487685.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17231137|ref|NP_487685.1|
Domain Number 1 Region: 2-112
Classification Level Classification E-value
Superfamily XisI-like 1.83e-42
Family XisI-like 0.0000373
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|17231137|ref|NP_487685.1|
Sequence length 114
Comment hypothetical protein alr3645 [Nostoc sp. PCC 7120]
Sequence
MDKLTDYPKLIQRILSEYIELSNRRSNPDIETFLIVDESKAQYIWMNLGWQNGERVTGMT
VYVRIRDGKFWIEEDWTEDGIATDLVRLGVPKEDIVLAFHEPSIRKYTDFAVVS
Download sequence
Identical sequences A0A1Z4KJX5 Q8YR13
103690.alr3645 gi|17231137|ref|NP_487685.1| WP_010997789.1.33676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]