SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17231925|ref|NP_488473.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17231925|ref|NP_488473.1|
Domain Number 1 Region: 36-154,181-340
Classification Level Classification E-value
Superfamily Pectin lyase-like 4.24e-33
Family Filamentous hemagglutinin FhaB, secretion domain 0.025
Further Details:      
 
Domain Number 2 Region: 537-637
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000000722
Family Chondroitinase B 0.09
Further Details:      
 
Domain Number 3 Region: 641-721,767-796
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000471
Family Filamentous hemagglutinin FhaB, secretion domain 0.047
Further Details:      
 
Domain Number 4 Region: 341-492
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000534
Family Filamentous hemagglutinin FhaB, secretion domain 0.052
Further Details:      
 
Weak hits

Sequence:  gi|17231925|ref|NP_488473.1|
Domain Number - Region: 719-870
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0738
Family Pectate lyase-like 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|17231925|ref|NP_488473.1|
Sequence length 1033
Comment hypothetical protein all4433 [Nostoc sp. PCC 7120]
Sequence
MSHHCIKIGISIILGVGAITGIEHPSNAEIIQDSTLPNNTNVTVTIGKENDTTFFIDGGT
AIGSNLFHSFSKFSLLKSQNAYFNSTENIQNIFSRVTGGEVSKIDGLITARSRVNLFLIN
PNGIIFGTNAQLNIQGSFVASTADSVRFAEGGEFITKPSSVTPLLNVTTPIGLQYGANSG
SIQLQGESIYQPSTLQVQGSQTLALIGGNVILGNANLSTIKSEGRIEIGGVSSAALVGIE
SVSSGFLFKFDKTSELGDIRLYSGTNINSLGDLNLTGKNIVIQDASLNVFNNLTVNAQER
VELTGRSAIDTGVPYNSPGNHVINTRNLLLNNQSFISINNGNLEVNASDSVQLTSDIKGV
PSRIYATASDGDVSSGNLTINTGYLLVDNGSQIITNSSTAFSGIIPRNVQTKASLTINAS
DSVTLRGNSFDEIYPSGVFTQTDGDGKTGDLTINTRVLRIEDGAQVIARNLSVGKSGNLT
VNATDKVGIIGTSPKGTIPGNWPNDSELDEQVPRTAGPLKELLITGVLRRDSLPSGIFTD
SVSSGDAGMITINTGELTAQNGGRISADTFSAGQGGDLMINATDKVELIGTAVNGVASGL
FTRSGSSATGNAGSLTIVTGNLLVKDGAQVSVSTFGTAQGGNLFVQAAEGIKLIGVSRRN
IASGLFAQANRYATGDAGSLKIDTSTLVVRDGAQVSASTFGAGKGGDLFVQASDIKLIGT
AADASFSSGLFTVATANSTGSAGKLTVNADLLDVQQGGGIAVQSSGKGSAGNLNINARRI
RLDDQAFISADTRDNGSDPKRSQANINLRSHNLILSRGSNITTNATGNNVIGGNIDIDTN
TLVAIQNSDISANSADFRGGRININAQNIFGTKFRNQRTPNSDITATGANPELSGAVEIT
TPDVDPSQSLSQLPSEAVDVSNQISQQCRIDEATAQRQNQFIITGRGGIPINPYEIFDNS
AVITDWVTINDVNSVAHKETDFAKEENTTADTIVEAQGWVYDAQGNLVLTAEATKITHHS
LGLTTDFCRINKG
Download sequence
Identical sequences A0A1Z4KM29 Q8YNX6
WP_010998568.1.33676 gi|17231925|ref|NP_488473.1| 103690.all4433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]