SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17232598|ref|NP_489146.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17232598|ref|NP_489146.1|
Domain Number 1 Region: 24-361
Classification Level Classification E-value
Superfamily Pectin lyase-like 5.34e-47
Family Filamentous hemagglutinin FhaB, secretion domain 0.017
Further Details:      
 
Domain Number 2 Region: 372-509,542-572
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000000377
Family Filamentous hemagglutinin FhaB, secretion domain 0.06
Further Details:      
 
Weak hits

Sequence:  gi|17232598|ref|NP_489146.1|
Domain Number - Region: 592-664
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000282
Family Filamentous hemagglutinin FhaB, secretion domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|17232598|ref|NP_489146.1|
Sequence length 815
Comment hypothetical protein all5106 [Nostoc sp. PCC 7120]
Sequence
MKFAFVGFVILSAICLSAVNNNGVYAQVTSDNTLGTVVDSNYSITNGIQVGNNLFHSFSQ
FSIPPGSSVSFDNATDIQNIFSRVTGGNISHIDGEISAKGNANLFLINPAGIIFGKNTSL
SIGGSFVATTANTIKFADGTEFSATKLSQSPLLTMSVPIGLQLGQNSGKIALQGTGHHLT
SQNPLITPYVPTVLETNLAVKSGRTLALVGSSIDLNGGILFAPQGRVELGGVTEGEVTLN
RVSQGFNLDYQKTSTFGDIDFTERSLVNVNGINAGSIQVQGRTVSLTDGSVLWVQNRGIQ
KGGDIYVFASDTLKLSGATTDLKIRTSIINEAVSSGRSGNISVVTPNLSVNNGAVVANRN
YKSADSGYINITTSNLNVNGYISTDPSVYAAIGTLTFSTGKAGDVIVATQNLSVLDGGYL
GSTTFGLGTSGTVTIDAAHVNVIGATPISIPSIISNTTIGRGGNAGKLRLNTRTLTIKES
GSVTTASLGVGNAGDLTVNATESINISGRSPSVPYGSNISSTVGSLTANYYTQLSNVSEI
PRGSSGQVTVNTPILKISDEARINTGNYGIGNAGALNINTEMVELNKGFLASFTASGQGG
DMNIHTNALILRDQSLIIGTALGSGDGGNIMINSPVIVGFNNSDIMANAVTGRGGNIQIT
TQGIFGLKFRPQLTPENDITASSQFGVNGTVQVNNVGVDPNSGLVELPANVTDPSQQIAT
GCSNANNSSFVATGRGGVPQNPTLEVRSDRTWSDIRDISAYRKINEVKAQIPTPPQTLVQ
ATSWHRNTDGKIEIVADKSSAQVQQLLTCAAVSQS
Download sequence
Identical sequences A0A1Z4KNY4 Q8YM35
WP_010999232.1.33676 103690.all5106 gi|17232598|ref|NP_489146.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]