SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17232604|ref|NP_489152.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17232604|ref|NP_489152.1|
Domain Number 1 Region: 22-376
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.32e-36
Family Filamentous hemagglutinin FhaB, secretion domain 0.02
Further Details:      
 
Domain Number 2 Region: 381-522,552-581
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000753
Family P22 tailspike protein 0.045
Further Details:      
 
Weak hits

Sequence:  gi|17232604|ref|NP_489152.1|
Domain Number - Region: 584-677
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0691
Family Filamentous hemagglutinin FhaB, secretion domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|17232604|ref|NP_489152.1|
Sequence length 833
Comment hypothetical protein all5112 [Nostoc sp. PCC 7120]
Sequence
MMKVTSVCLGLACVFLAAGRSLPATAQVTSDGTTNTTVNPSSNNFQIINGTARGNNLFHS
FSNFSLPKDTSATFDLTNTPNITNIFSRVTGGNISHIDGLIETIKSNNPVSLFLMNPAGI
VFGSNASLNIGGSFVGTTANSLKFADGTEFSANNPSSIPLLTMSVPIGLQMGSNPNPIIV
EGTGHALTAPSTVAPITQNPSASELRVKPGKTLALVGGNLNLIGATLNAPEGRLELGSLS
GVGMVSLNPIAQGYQLSYQSGQSFADIQLTQKSLLTVGALLSAGALNAGSAQLQGRHIQI
SDGSIIFSKNLGNVAGGETFLQASEGIEIFGTTANAQIRSGIRSEGLNTGTGSSIYIITP
HLTISQGAGVNTNAFGSSASGDIQIDAERVELSGFSPINPTGVTSLTTSSRTAKSAGNLS
INSNSLLVSQGAAISSLALASGSTGQVTIRSKNTTVTGDNPAGLYSNISAITYGTGEAQT
LTLDTDRLQLLNGGAVATTSFLIGEAGNLNINAKESILIDGRSQTNNSSINSAVLSSTAL
IKQLFNLPNILSANAGTVNVTTPTLTLTNGGAVSVTNEGTGDGGHINITANRIFLDRQGS
IQAQTLSGEGGNITSQVSDLLLLRHNSLISATSGGTGNGGNISINAPVIAGLENSDIIAN
AVKGRGGNIDISTQGIIGLAFHNTLTPRVDQTNDITASSEFNINGTVKINNIGVDPNSGL
VELPENITDPSQQIATGCSNTFGSSFVATGRGGIPQNPTQDVRSDRTWSDTRDISAFQNR
PQIQAQIQKSPETLVQATGWRRNANGKIELRVAQSPAHVPSPSYLTCAAVSQN
Download sequence
Identical sequences Q8YM29
gi|17232604|ref|NP_489152.1| 103690.all5112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]