SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17232607|ref|NP_489155.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17232607|ref|NP_489155.1|
Domain Number 1 Region: 31-361
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.08e-33
Family Filamentous hemagglutinin FhaB, secretion domain 0.011
Further Details:      
 
Domain Number 2 Region: 464-665
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000235
Family P22 tailspike protein 0.087
Further Details:      
 
Weak hits

Sequence:  gi|17232607|ref|NP_489155.1|
Domain Number - Region: 668-762
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0753
Family Filamentous hemagglutinin FhaB, secretion domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|17232607|ref|NP_489155.1|
Sequence length 913
Comment hypothetical protein all5115 [Nostoc sp. PCC 7120]
Sequence
MRQPFFGWGLANRIITSSLLLPLGIILWNSCASAQVTSDGSLNTDITKNGNHFTITNGSA
SGSNLFHSFGQFSVPNPGSATFDLVNTPNISTIFSRVTGGSISHIDGLIQTINSKNPVSL
FLLNPSGIVFGPNARLNISGSFVGTTAESIQFADGSKFSATDSTTQPLLTMSVPVGLQLG
SNAGAIRTQGTPALNFLFRPAQSFKAQTVALVGSEIDLNQTSLANPDGRVELWALRNAEV
GLNNQTGLQLTSPTTADWGLISLRQASYIDTSGINGGAINIRGRGLTLQEGSGITSATGA
SGQGQGITVKTTEFIDLLGVSDPQNYDTPGLFTTVSGSGAKAGDITIETESLRIQNGAWL
QSINNGFTFDFSTFSLTPINDTTTGNITVSAKDVEVSGYNPFPNPFTGVANFRPSAITTL
VNSGKRNNSGTITIEANQVRLLNGGRISASIIGFPIPGLDSITIGNSGDISIQASESLEI
NGTTAGGLSGAIISSIQAFAQGEAGNITINTGNLRVTNGGSIASELSGTGNAGNIAIQAQ
NVEVSKPTLDSFSNTVSGITVAVNKNAIGDGGNINLQAERLRVFQGGQITSSSLGQGSAG
TVNLLVNDIDVQGLSKPLRDGRILPSTITASATNNFSARSVNINADRLSVRDGAEITVSN
LGSGDAGNLNINASQIFLDNGASLRAEVNGGGRGNIQLSASDFVLLRHGSNIVTNARGTS
TGGNINISAESIIAVPKENSDIAANAVLGRGGNILITTQGLLGFEFRDRLTPDSDITASS
QFGLSGTVQVNTIGVDPNSGLVELPANVNDPSQKVSTGCSGDNGSSFVATGRGGIPQNPN
QEVRSDRTWSDVRDISAFHKTGNVTAQIPTTPQVLIRATSWHRNAQGKIELVADNSPNQV
QPSLTCAAVPKIQ
Download sequence
Identical sequences A0A1Z4KPD4 Q8YM26
gi|17232607|ref|NP_489155.1| 103690.all5115 WP_010999241.1.33676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]