SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17232772|ref|NP_489320.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17232772|ref|NP_489320.1|
Domain Number 1 Region: 22-164,194-326,371-398
Classification Level Classification E-value
Superfamily Pectin lyase-like 6.28e-40
Family Filamentous hemagglutinin FhaB, secretion domain 0.0098
Further Details:      
 
Weak hits

Sequence:  gi|17232772|ref|NP_489320.1|
Domain Number - Region: 357-470
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000245
Family P22 tailspike protein 0.099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|17232772|ref|NP_489320.1|
Sequence length 770
Comment hypothetical protein all5280 [Nostoc sp. PCC 7120]
Sequence
MSNLGMYVKVLGVAVSSLIIFSVNSAIAQITQDSTLPENSRVTKQENNIIIEGGTLSPDR
RNLFHSFREFSVPENYTAEFKTIGSVQNIISRVTGSSISSIDGIIKSDSTANLLLINPNG
IIFGSNAALNIRSSFLASTANSLNFADGTQFSTINPQNTFVLTVSIPSGLQFGATANPIK
NQSQARNISGRSVGLQVPNGNTLAFVGGNITLEGGNLTVPSGKIELGSVAPNSLVILNPI
NQGWLIGYQGVQEFRNIQLRIRQGANGRQLPSQIDTTGNNGGEIRLQGNSVELSGESVRL
RSITTGNANGKDITINATKLIVQNGAQIATSTISRGGSGNLLINAFESVDIIESDTLSST
ITGLIGISAGQGRASDIKITTGKLRILNGGVVTADSSGFLRTNDSPVIPAEGKGGNIIVN
ASESVEIAGNVKTRFSSVLSAGTRNAQNAGTVNITTGKLIVRDGGQLSVNVGAFNNPVNS
GTPGKLNITAKSILLDNQGQITSNTRSGQGGDINLLVQDSLQMRRNSLISTSAGTSNAPG
NGGNITINAPNGFVFAAPLGNNDITANAFSGIGGKITINAKKIFGFIQRDRSDLVRLLNT
EDPNLLNPNKLPTSDITAFSQQSPSFNGIVQINTPDADPNKGLVELPSNLINASEQIAAS
CSPHRGLQRNSFVSTGRGGIASSPTDTLIDDAVLVGWTVLPTQINDSADRIPEQHTQQVN
LSASPQIVEAQGWQIDRNGNVVLVAQAPIVIPHTPTLHSSACALLGSRGE
Download sequence
Identical sequences Q8YLL8
gi|17232772|ref|NP_489320.1| 103690.all5280 WP_010999404.1.33676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]