SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17233251|ref|NP_490341.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17233251|ref|NP_490341.1|
Domain Number 1 Region: 26-366
Classification Level Classification E-value
Superfamily Pectin lyase-like 4.71e-30
Family Filamentous hemagglutinin FhaB, secretion domain 0.007
Further Details:      
 
Domain Number 2 Region: 379-400,435-546,580-607
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000832
Family P22 tailspike protein 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|17233251|ref|NP_490341.1|
Sequence length 843
Comment hypothetical protein all7235 [Nostoc sp. PCC 7120]
Sequence
MNSKFTILFTEISFLITIFTTFIPLCQAQINADNSSQNNSAVNVQGNTIFIEGGTQLGGN
LFHSFKDFSINYGDTAYFNNASIIQNIISRVTGNSISNINGTIRNNGQANLFILNPNGFF
FGNSARLNIGGSFLATTANSIKFSNNIDFSANRNQLDPLLKVSVPVGLVFIGNSGEIRLQ
GSGHNINRIANRNFDFITPIDASRFSGLQVQPGNNISLIGGNVSLEGGILSTRNGKFQIG
SVLDGYVGLEQQGNDINFDFNNVNTFRNITLIKNSLLFVNSNADTSNTIDIQGKNINILD
GSLVFTQNHGFKTGAVKIDAQSLNIQGSSNLALSAIYTSNFGFTPGESIQLDVKDVTIQG
GQIATTTFTNAPSGLITINSNSLKISGDTPSYANPDGLGGINTFSYSSGKGGDIAGKINN
IIIGLDGVFNTVASGSGAGGNLFLELENLIIKDGGASLGSSTIRSGQGGNVFIKSQNIDI
SGQSALLRPSNITSSTFGHGNGGNIDINTLNLIISNGGGISSSTLSAGKAGNISINSSNS
INVVGTNINSNSPSFINSSNFLLVDPNLQKLLYRQPPLLIGQAGNIFLNTDIINISNGGL
INARNEGVNDAGNIRISANTININSQGEVNATTTIGEGGNIILNSRNLFLNNSRITATAG
GTGNGGNIRMNTGILVGSNNNQIVANAFEGRGGNIRINAQGVFLSPNTQVNSKSQRGIDG
TVDINANIFLAETPVKSQTVQELPQIASACQGRSNGINEFIVAGTGGLATSPEDLPDVES
RWQVNSTTNISNIKLSAGNEIIEAQGWVKNLDGSITLTAQANKVSPDTTLSASECHSQTK
PKA
Download sequence
Identical sequences A0A1Z4KUJ1 Q8YKQ8
gi|17233251|ref|NP_490341.1| gi|17233251|ref|NP_490341.1|NC_003276 103690.all7235 WP_010999788.1.33676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]