SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|62946410|ref|YP_227615.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|62946410|ref|YP_227615.1|
Domain Number 1 Region: 24-261,303-399
Classification Level Classification E-value
Superfamily Pectin lyase-like 7.53e-51
Family Filamentous hemagglutinin FhaB, secretion domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|62946410|ref|YP_227615.1|
Sequence length 688
Comment hypothetical protein all7313 [Nostoc sp. PCC 7120]
Sequence
MSGISIHWYWLQGLGITISSTTVFWSNCSLAQITPDTTLPINSNITTEGNTRIIERGTQA
GSNLFHSFQEFSVPTSGTAFFNNPTNIQNIISRVTGGSVSNIDGLIRANATANLFLINPN
GIIFGQNARLDIGGSFVGSTANRLKFADGFEFSATAPQKTPLLTINIPTGLQFGENPGDI
RVQGIGGQLSSEEGQGLRVPLGKTLALVGGNVTIERAFLNAPGGRIELGSVTGVNQVNLN
QTHQGWTLNYQNVSNFRDIQIFRSFVNITPEEDSNIQSQQESSAISFRASQLNLETSVIR
ANTFTSAPGGNVSINVQQLIMKGGASIVTQVFDTGSGGDLTINALDSVELIGTPVEFPID
TILSTQTSGAGKAGSVTINTPVLVLKDRATISATTFGVGKAGNLIINTRELLVKDRAGMF
VRSRGIGNAGSLIINASSVHLDNGTLTANTRSINTDPNQTQATITLRVKDLVLLRRNSNI
TADATGENVIGGDVNIDTKFLVASENSDITATSNDFRGGRVRVKAIGIFGTQSQNERTSA
SDITARGKTPELSGSIELNTPDVDPSRGLVELPVNLVDASQQIAQGCTPRRGQSNSFVVT
GRGGMPLSPSEPLRQRAVITQWVTLDEEIGNETNTQAKTTLAENQQPIVEAQRWLVDKRG
DVQLVAQQVLNEMRIQESGVISCSVNRL
Download sequence
Identical sequences A0A1Z4KV19 Q8YKI4
WP_010999863.1.33676 gi|62946410|ref|YP_227615.1| 103690.all7313 gi|62946410|ref|YP_227615.1|NC_003276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]