SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76800691|ref|YP_325699.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76800691|ref|YP_325699.1|
Domain Number 1 Region: 98-230
Classification Level Classification E-value
Superfamily Riboflavin kinase-like 1.08e-44
Family CTP-dependent riboflavin kinase-like 0.00013
Further Details:      
 
Domain Number 2 Region: 31-92
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000161
Family MarR-like transcriptional regulators 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|76800691|ref|YP_325699.1|
Sequence length 232
Comment rib operon protein [Natronomonas pharaonis DSM 2160]
Sequence
MSQTTERVGADELSTLKLVALDGALDGRVTVTCADLADRLDASNQTASRRLQRLEAAALV
ERDMTGEGQRIAVTEAGERALQREYADYRRLFEGDADVTLSGVVTSGMGEGRHYISLSGY
MRQFRERLGYEPFPGTLNVDLDDGSVRTRARMDALDPVKIDGWEDDERTYGPAFCWPAVL
ETADGDRYGTAHVIAPERTHHGDDQLEIIAPEKLRETLSLDDGDTLSIHVSE
Download sequence
Identical sequences Q3IUQ3
WP_011321766.1.57290 348780.NP0072A gi|76800691|ref|YP_325699.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]