SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76800703|ref|YP_325711.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76800703|ref|YP_325711.1|
Domain Number 1 Region: 98-292
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.95e-42
Family Nitrogenase iron protein-like 0.00000667
Further Details:      
 
Domain Number 2 Region: 292-429
Classification Level Classification E-value
Superfamily Signal peptide-binding domain 5.63e-37
Family Signal peptide-binding domain 0.00011
Further Details:      
 
Domain Number 3 Region: 1-90
Classification Level Classification E-value
Superfamily Domain of the SRP/SRP receptor G-proteins 2.62e-23
Family Domain of the SRP/SRP receptor G-proteins 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|76800703|ref|YP_325711.1|
Sequence length 466
Comment signal recognition particle 54K protein [Natronomonas pharaonis DSM 2160]
Sequence
MVLDDLGSSLRGTLDKLQGKTTLSEDDVEEIVKEIQRSLLSADVDVDLVMDLSDSIRERA
LDEEPPAGTTARDHVLKIVYEEMVELVGESTALPLEEQTIVLAGLQGSGKTTTAAKMAWW
FSKKGLRPAVIQTDTFRPGAYDQAKEMCERAEVDFYGNPDSDDPVEIAERGLEETADADV
HIVDTAGRHALEEALIDELEAIESAVDPDRNLLVLDAAIGQGAKDQAERFHDAVGIDGVA
ITKLDGTAKGGGALAAVDQTDSSIAFLGTGEEVKDIERFEPSGFISRLLGMGDLKQLSER
VERAMEETQAEEDWDPEDLMKGEFTLKDMRNQMNAMNKMGPLDQVMDMIPGLGGGIKDQL
PDDAMDMTQERLRDFEVIMDSMSEAELENPRAIGQSQIERIARGSGTDEDTVRELLEQHK
MMSRMMKQFQGMGDGDMQRMMKQMQQGGGGGGGGGGGLGGMGPFGD
Download sequence
Identical sequences Q3IUP1
WP_011321778.1.57290 348780.NP0096A gi|76800703|ref|YP_325711.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]