SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76800746|ref|YP_325754.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76800746|ref|YP_325754.1|
Domain Number 1 Region: 168-367
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.1e-49
Family Nitrogenase iron protein-like 0.000011
Further Details:      
 
Domain Number 2 Region: 86-155
Classification Level Classification E-value
Superfamily Domain of the SRP/SRP receptor G-proteins 0.00000000000393
Family Domain of the SRP/SRP receptor G-proteins 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|76800746|ref|YP_325754.1|
Sequence length 368
Comment signal recognition particle receptor SRalpha [Natronomonas pharaonis DSM 2160]
Sequence
MFEGLKDKLSSFKGDVEEQADEPDSEADAAEPETADAEAAAEPEASSTDTDTGEPDSVTE
PEPDSDPETDAEDDPGLAKKAALAATGRTIITEEELEEPLEQLELELLQGDVEMSVAQEI
TDRIREELVGETRKQVESGEQVVERAIAEALRDVISVGQFDFESRIADAEKPVTIVFTGV
NGVGKTTSIAKLARWFEERGHSSVLANGDTYRAGANEQIEEHADALDKKIITHEQGGDPA
AVIYDAVEYAEANDVDVVLGDTAGRLHTADDLMAQLEKIDRVVDPDLTLFVDEAVAGQDA
TNRAKEFNDAAEIDGAILTKADADSQGGAAISIAHVTGKPILFLGTGQGYDDIERFDPDE
IVSRLLEA
Download sequence
Identical sequences A0A1U7ETF6
348780.NP0182A gi|76800746|ref|YP_325754.1| WP_011321821.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]