SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76800822|ref|YP_325830.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76800822|ref|YP_325830.1|
Domain Number 1 Region: 64-200,355-493
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.06e-48
Family Tandem AAA-ATPase domain 0.000042
Further Details:      
 
Domain Number 2 Region: 628-760
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 8.31e-28
Family XPF/Rad1/Mus81 nuclease 0.000038
Further Details:      
 
Domain Number 3 Region: 776-838
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.0000000000000508
Family Hef domain-like 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|76800822|ref|YP_325830.1|
Sequence length 845
Comment Hef nuclease [Natronomonas pharaonis DSM 2160]
Sequence
MATAAEDTEYIEGPLLAEGLLEKRRYQLKLAETAAEDHTLVCLPTGLGKTAVSLLVTAER
LADRGGKALLLAPTKPLVQQHAAFYREALTLADDEVVVFTGAVRPDDRAALWEDASVVCA
TPQVVENDLVGNRVSLRPVTHLTVDECHRATGDYAYNYIAERYHEDAAKPLVTAMSASPG
GDKEEILTVCDNLGLREVAVMTEADADVDEYTHHTDVEWERVELPEAVIDIRDNLNEVIT
ERLTKLKELGVTTSTDPNMSQSQLNAIRAKLQELINNDDSSGYKGMSAHAEIMKLRRAVE
LVETQSVESVRRYFERQREDAKSSGASKASQRFVSEPRVQAAMRKATAFDDLHPKFRRTR
ILLAQTLGIEGGERVIVFTESRDTAESLTAFLGEHFETRRFVGQGDKDGSDGMTQTEQKE
TLDAFRSGEFEVLVSTSVAEEGLDVPDVDLVLFYEPVPKGIRSIQRKGRTGRASDGRVVV
LLAEDTRDEAFFWMSRNEEKRMEEELRKLKSIEGEIEAEIAQADLGSFAEAPPEGSEESE
HTAEDEAESGEAEPPDSGGGESNDGNQAETSGDTAEVAPDTDSNGGDAAEPAEDADRQVG
LTDFAAEADGTDTDEAGTVATAAPEGETVEIVADQRELDSHIARDLSMRDGVETRLETLA
VGDYVLSDRVVVERKAVEDFLETLVGGDRSMFEQVGAAARHYGRPVVIIEGEGLYERRNV
HPNAIRGAVASLAVDFGASVLRTTDTDETADLLEVIATREQETDDRSVSVHGEKGGKTLA
EKQEYVVSAVAEVGPVTARALLEHFGSVEAVMSADEEALQAVDGVGDVTAERIRDVTGTT
YADSS
Download sequence
Identical sequences A0A1U7ETL9
gi|76800822|ref|YP_325830.1| WP_011321897.1.57290 348780.NP0336A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]