SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76800839|ref|YP_325847.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|76800839|ref|YP_325847.1|
Domain Number - Region: 77-135
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.068
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|76800839|ref|YP_325847.1|
Sequence length 161
Comment hypothetical protein NP0370A [Natronomonas pharaonis DSM 2160]
Sequence
MTLSEEAESRLADIVSLQPTKNSELQERWGLDGGSEVHQYLESELKEYYYRDENSLIRAT
PEAAELVGIDTDEDIVRVPPLQSDIIDVLAGPDGEPQSVVSVLHDLEDAGIETDVDAVRS
GLRSLEDKGIVAVIKKTVPTFRLAVERDDIEVETLEEPAHA
Download sequence
Identical sequences A0A1U7ETN3
348780.NP0370A gi|76800839|ref|YP_325847.1| WP_011321914.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]