SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76800944|ref|YP_325952.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76800944|ref|YP_325952.1|
Domain Number 1 Region: 165-315
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.49e-35
Family G proteins 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|76800944|ref|YP_325952.1|
Sequence length 327
Comment GTP-binding protein [Natronomonas pharaonis DSM 2160]
Sequence
MHFEDLPTTPRSEELVDKAFSRAARAGRAKQGKEAQESMLQTASNILSDNLENVVTSWPD
FELVDTFYYEFADATLADTDVGGVDPLRQHLSEVMWAGRQADKIKDEYHGRIRNSDTDTA
RKLRKQAFARLADITEQVEDDLLAIGTAREALKTLPDIRADEPAIVVAGYPNVGKSSFVN
TVTNARNETAAYPFTTTEINVGHVEDNHVRYQLIDTPGLLDRPSEDRNPIESQAVSALTH
LADAVLFVLDASGECGYPLDSQRDLLDDIESTFDVPVIVVCNKADRSTDTEADHYMSVET
GENVDEVLDAAIDAVDYELELPFEDDE
Download sequence
Identical sequences A0A1U7ETX1
348780.NP0584A WP_011322019.1.57290 gi|76800944|ref|YP_325952.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]