SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76800988|ref|YP_325996.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76800988|ref|YP_325996.1|
Domain Number 1 Region: 3-145
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 3.47e-28
Family TehB-like 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|76800988|ref|YP_325996.1|
Sequence length 211
Comment S-adenosylmethionine-dependent methyltransferase 3 [Natronomonas pharaonis DSM 2160]
Sequence
MVDWDERFESGSYPQHPDPAPVLKRYVDGSGDGRALDVATGTGRNAVFLAEHGYAVDALD
KSRAGLETTRRNAAERGVAGNLNCIQTDIPSHTFPEGTYDIVTVSFYRAVDRFPDLKAAL
APGGLFFVEHHLRTADPVEGGPSGDRYRFAANELLNSCLDLTVLSYEEGIEVRDDGRESA
IARIVARNASGRQSYPRIREWQRQESGGGRP
Download sequence
Identical sequences A0A1U7EU11
WP_011322063.1.57290 gi|76800988|ref|YP_325996.1| 348780.NP0672A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]