SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76800991|ref|YP_325999.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76800991|ref|YP_325999.1|
Domain Number 1 Region: 343-547
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.14e-40
Family ABC transporter ATPase domain-like 0.0011
Further Details:      
 
Domain Number 2 Region: 112-299
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.03e-31
Family ABC transporter ATPase domain-like 0.0036
Further Details:      
 
Domain Number 3 Region: 7-143
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 8.7e-18
Family 7-Fe ferredoxin 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|76800991|ref|YP_325999.1|
Sequence length 612
Comment ATPase RIL [Natronomonas pharaonis DSM 2160]
Sequence
MSDDSIAVVDLDRCQPDRCNYECVNFCPPNRTGEECIITREERYEDDDHYAGGADQVSIS
EELCLGESCGICVEKCPFDAIEIINLPQELDENPTHRYGANSFALYGLPAPQEGRVTGIL
GPNGIGKTTAVHILADEITPNLGRFDDEPDWEAVLEAYRGTALQGYLDDLVDGDMTVARK
PQYVDRIPESFDGKTRELLDGVDERGVADELVERLEIEAVIDQPIDTLSGGELQRVALAA
TLVRDADFYFLDEITPYLDIGQRVTAARLIQELSEDDRSMLVVEHDLAVLDLLADALHVA
YGEPGVFGVVTPPKSTKSGINEYLKGYLENENMRIRPEAIEFEEHAPRTESFGETLVEYP
DLTKSYGDGEFTLDVEGGQIQNNEVLGIVGPNGIGKSTFAKLLAGRLDPDSGSFDADLDI
SYKPQYVEIDQPMRVDAFLRSITDDFGSSYWNTEIAQPLQLDRIMEQDLTDLSGGERQRV
AIAACLSKEADIYLLDEPSAHLDVEQRVLATRAIRRYTETHDKTAMVIDHDIYMIDLLAD
RLQVFEGTPAEHGRAGSPVGMREGMNTFLSNLDVTFRRDERTGRPRINKPGSQKDREQKK
QGEYYYAPAENQ
Download sequence
Identical sequences A0A1U7EU09
348780.NP0678A gi|76800991|ref|YP_325999.1| WP_011322066.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]