SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76800999|ref|YP_326007.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76800999|ref|YP_326007.1|
Domain Number 1 Region: 354-571
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.98e-37
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00083
Further Details:      
 
Domain Number 2 Region: 289-362
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000119
Family Domains B1 and B5 of PheRS-beta, PheT 0.0064
Further Details:      
 
Domain Number 3 Region: 5-74
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.000000156
Family Domains B1 and B5 of PheRS-beta, PheT 0.0056
Further Details:      
 
Weak hits

Sequence:  gi|76800999|ref|YP_326007.1|
Domain Number - Region: 208-252
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.00196
Family B3/B4 domain of PheRS, PheT 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|76800999|ref|YP_326007.1|
Sequence length 572
Comment phenylalanyl-tRNA synthetase subunit beta [Natronomonas pharaonis DSM 2160]
Sequence
MPVVEVDPDELRSLAAIEDKSDDELKDDLFALGLEFEGESDDGDFELEFAPDRLDRLSVE
GIARSLRYQYGHDRGIDVPKTNDAEWTITVDESVPEARPYVTGAVVRGLDLDDTQLDSLI
QLQEKLHATMGRNRAKGAIGVHDLTMLKGGGARSDGKPSKSITYRGVDPDGDRFVPLDDD
AERTPAEVLDAHPTGETYGHLVDGLDRFPAIYDDIGLFSFPPVINGSRTEVDTGTRDLFI
ELTGTDQWTIDRMLAIICYALSARGGRIESVAVDYGDRTLTRPDLSTTTKTVSHDRIETT
LGVDLAGTDVVDLLERSGLDAEADTEGELTYEVEIPAYRVDVLHPADIVDDVGRAFGFNE
LEPQYPDVSTVGGRHDRSRLEDAVRNTLVGLGFEDLLNFYMTSETELFDRMSLSPDDNAV
GAREPPTITEPYSEDYTVVRTWALPSLLMVLENNTHRAYPQDLAEIGLVAGVDESKPTNV
AEHRSVAGVVARTDASYEDAKARLQAIGSAFGVDIKTPPTDHPSFIDGRTAAVVIDGEPA
GVIGELHPRVLVEHDLEVPVAGFEFRLDALAD
Download sequence
Identical sequences Q3ITU5
gi|76800999|ref|YP_326007.1| 348780.NP0694A WP_011322074.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]