SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76801007|ref|YP_326015.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76801007|ref|YP_326015.1|
Domain Number 1 Region: 60-274
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.73e-53
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00094
Further Details:      
 
Domain Number 2 Region: 615-763
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.24e-41
Family AlaX-like 0.058
Further Details:      
 
Domain Number 3 Region: 315-501
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 1.57e-41
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.00019
Further Details:      
 
Domain Number 4 Region: 518-605
Classification Level Classification E-value
Superfamily Translation proteins 3.53e-17
Family AlaX-M N-terminal domain-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|76801007|ref|YP_326015.1|
Sequence length 932
Comment alanyl-tRNA synthetase [Natronomonas pharaonis DSM 2160]
Sequence
MSDLDEEYQLDYFHEEGFERKECPSCGAHFWTRDSERDICGEPPCADYDFIGDPGFDTEY
SLEEMREAFLSFFEDHDHERIEPYPVAANRWRDDVLLTQASIYDFQPLVTSGETPPPANP
LTISQPCIRMQDIDNVGKTGRHTMAFEMMAHHAFNAREDIDDPDQYAYEGEVYWKSETVA
YCDQLLDELGADIEDVTYIEDPWVGGGNAGPAIEVIYRGLELATLVFMCMEQDPDGDYEL
KDGNRYSYMDTYVVDTGYGLERWTWMSQGTPTVYEAVYPEMISFLKDNAGLDYSDREESL
VNRAARLSGKLDIDDVDDVEAARDDIADELGVETDELRALVEPLEDIYAIADHCRTLAYM
LGDGIVPSNVGTGYLARMVLRRTKRLADGVGVDAPLDELVDMQAERLDYENRDTVRDIVR
TEVEKYRETLERGRRHVERLAEEYAQKGDPIPLDEVIELYDSRGIQPETVEEIAADHGAD
VEIPDDFYSLVAERHGEADADADDGTLAGDDDRIADLPETEKLYYEEPERTDFEAVVLDV
IERDADGETVYDVALDQTMFYPEGGGQPADTGTLSTDDVAAEVTDVQETNGVVLHRTDEA
PGKGEFVRGQIDGVRRRRLMQHHTATHIVGHAARQVLGDHVRQAGAQKGVESARFDIRHY
ERISREEVKRIERVANNIVTDNLPVKQEWPKRNEAEADYGFDIYQGGIPPGETLRLIQVG
EDVQACAGTHVLQTGDIGTIKILSTERVQDGVERLVFAAGDAAIEATQRTEDALYDTAEV
LDVSPQEVPATAERFFEEWKDRGKRIEELKEQLAEARAHGGDGGEEVDLGGTTAVVQRVD
GDMDDLRATANALVEDGTVAVLGSGDDSATFVVAVPDNVDINAGAVVGELADRVGGGGGG
PPDFAQGGGPDVDSLDEALDAAPEILRSMLEA
Download sequence
Identical sequences Q3ITT7
gi|76801007|ref|YP_326015.1| 348780.NP0710A WP_011322082.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]