SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76801027|ref|YP_326035.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76801027|ref|YP_326035.1|
Domain Number 1 Region: 311-460
Classification Level Classification E-value
Superfamily FomD-like 5.49e-29
Family FomD-like 0.011
Further Details:      
 
Weak hits

Sequence:  gi|76801027|ref|YP_326035.1|
Domain Number - Region: 87-143
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000785
Family Cold shock DNA-binding domain-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|76801027|ref|YP_326035.1|
Sequence length 461
Comment hypothetical protein NP0750A [Natronomonas pharaonis DSM 2160]
Sequence
MNVRVRGIYTTALTELLGGEYDIVQASPPIQRRFEASFPVAVADATVRTSDDRLGAGIAG
TADAVDAVGETLSALGRDTFRWTDPAPRGAVFYGEVTETLGSGAVVDLGTVDGDSVEGFL
PYNRVEGYVDEGDSYRVQVASPEPPWGDARPSLATALRIPGGLVELRRGSEGGLSETARM
ADLLPVDPPEGWTPNWSRAADDASLEAMEAALRRASDRAETVMEAVVDADRDEPGRIVAP
QAGAWLLFGRESRFELDEYRRQIETTMPGHHRTKAATTAASAAVDFAEALCEPDGAFPFD
VVTRQFGPTEGDDVTISHGKPDGRTISLGRGEVTDRDPEAESITVEREMSGGGTYDAIGV
KREAGDIATTTFVEGRWWYPTVYCSADGERRGTYVNICTPLEVFPDTVRYVDLHVDVVKG
PDGDVRRVDDDELDAAVEAGEISEPLAERAREVAAAIKKAL
Download sequence
Identical sequences Q3ITR7
WP_011322102.1.57290 348780.NP0750A gi|76801027|ref|YP_326035.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]