SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76801223|ref|YP_326231.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|76801223|ref|YP_326231.1|
Domain Number - Region: 211-247
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00474
Family MarR-like transcriptional regulators 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|76801223|ref|YP_326231.1|
Sequence length 250
Comment hypothetical protein NP1142A [Natronomonas pharaonis DSM 2160]
Sequence
MRSETELRPVQEVHVAPVGYEYDRIKRPALEYGADTLYLLRERERTELSYHDRLVTELTD
RGMTVRSREVDLDDMYDVLGEVTTIVHGHDGDIVRVNVSSGPKLSTVGAALACMATDASG
YHVHPETRAHPLDEQPRTEGMQFAEQLPSYPLETPTEDQVRVLDYIDRRDSETYTPKKSD
LIEFAEDEQLDFLTRSEPANDKAKFALLNNRILEPLSANGYVHIEPVGRTKQVSLTDTGE
NALRAFRHKL
Download sequence
Identical sequences A0A1U7EUK8
348780.NP1142A WP_011322298.1.57290 gi|76801223|ref|YP_326231.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]