SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76801256|ref|YP_326264.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76801256|ref|YP_326264.1|
Domain Number 1 Region: 2-179
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000038
Family RecA protein-like (ATPase-domain) 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|76801256|ref|YP_326264.1|
Sequence length 187
Comment KaiC-like transcriptional regulator [Natronomonas pharaonis DSM 2160]
Sequence
MYPTGLPELDRHLGGGVPPGTLVALTAPPNTQSERLLERLAAANETRYVTTLRDAARVRD
RLPEASVLSATPDDLLFDPETYLSIPSSGCLVVDSVTELERDTDTYREFLETAARETAES
DGIVVLHAHEAEPNPPERWLTLARADMTVQLSLEVSSDAVTNRLAVTKHRGGAVPEKPMQ
VRLSEDT
Download sequence
Identical sequences A0A1U7EUP7
348780.NP1208A WP_011322331.1.57290 gi|76801256|ref|YP_326264.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]