SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76801260|ref|YP_326268.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76801260|ref|YP_326268.1|
Domain Number 1 Region: 502-689
Classification Level Classification E-value
Superfamily Smc hinge domain 4.97e-48
Family Smc hinge domain 0.00045
Further Details:      
 
Domain Number 2 Region: 1-231,1082-1168
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.38e-42
Family ABC transporter ATPase domain-like 0.00015
Further Details:      
 
Domain Number 3 Region: 699-964
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000034
Family Tropomyosin 0.001
Further Details:      
 
Domain Number 4 Region: 397-513
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000241
Family Myosin rod fragments 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|76801260|ref|YP_326268.1|
Sequence length 1192
Comment chromosome partition protein [Natronomonas pharaonis DSM 2160]
Sequence
MHIKALVLDNFKSFGQKTKIPLYEDFTTISGPNGSGKSNIIDSILFALGLARTSGIRADK
LTDLIYNPGHDDDGSGFGGEREASVEVVLDNSDGTLSREQVVSAAGSENVGDIDEITIRR
RVKQTDEETYYSYYYLNGRSVNLSDIQDLLAQAGVTPEGYNVVMQGDVTEIITMTPGSRR
EIIDEIAGVAQFDAKKEDAFEELGTVQERIDEADLRIEEKQQRLSQLEDERETALEYQDL
QEEKAEYEGYLKAAELEDKREERSSVRERIEETEATLETKQRTLDERQGRVSRLEDDLEE
LNAEIERKGEDEQLEIKREIEEIKGDISRLEDKREAERERLEDAENERRQAFVQVDRKQE
ELDDLEADIRNKKVEKSSIKADIQEKEAELEAVEAEIEAVDSEYEETRDELESHRERVQE
LKDERNDLQREQDRLLDESRRRTKEERETESALEDAEEKLPELDAERADLENELKKAEAN
RETITEVVEDLKSEKRRLQDDLEDLEDDISAKQQEYAELEARAGDSGDASYGRAVTTVLN
ASIDGVHGTVGQLGGVDPEYATACETAAGGRLANVVVDDDSVGQQCIEHLKSRNAGRATF
LPMTEMHNRSLPSTPDLPGVVDFAYNLIDFDSRYAEVFSYVVGDTLVVEDMATARDLMGE
FRLVTLDGDLVEKSGAMTGGSKSGSRYSFSKRGKGQLERVAERITELEDEKQSLREELRD
VESRLDDARDRQTDAAEQVRDIEADIEAIEEKRGEVEGRIEELEAELEELEAEREQVAEE
MSDVEAEIEAKDDEIEAVEDDIEELAARIENSEIPELTSEAEAIREDIAELEARADDIDG
DLNELQLEKQYAEEAIDELHDDIETAQNRKADAEAEIETLDAQIESKETTLAEKKEAVTE
LEDELASLKDDREALKADLKAAKSKRDEAEAAVSSVKSKLESLTETEERLEWEIEELEAE
VDEYDPESIPDHDTVETRITELEAEMSALEPVNMLAIDEYDEVEADLDELEAKRATLAEE
ADQIRDRIDAYEDRKRETFMDAYESINEQFADIFSRLSGGSGELVLEDPEDPFEGGLTMK
AQPGDKPVQRLDAMSGGEKSLTALAFIFAIQRHNPAPFYALDEVDAFLDAANAEMVGEMV
EELAGDAQFVVVSHRSALLERSERAIGVTMQENNVSAVTGIDLSEMGVPADD
Download sequence
Identical sequences A0A1U7EUN2
348780.NP1216A gi|76801260|ref|YP_326268.1| WP_011322335.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]