SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76801356|ref|YP_326364.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76801356|ref|YP_326364.1|
Domain Number 1 Region: 7-133
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.69e-39
Family YigZ N-terminal domain-like 0.0002
Further Details:      
 
Domain Number 2 Region: 137-198
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.00000222
Family YigZ C-terminal domain-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|76801356|ref|YP_326364.1|
Sequence length 199
Comment hypothetical protein NP1410A [Natronomonas pharaonis DSM 2160]
Sequence
MSSTDAYRTIDGRARSAFTVQGSEFIGHAAPVETVAKAEAFIDDVAAEHADATHNVPAYR
VRADPFREYSSDDGEPSGSAGKPMLSVLGGRELENVCVVVTRYFGGTKLGVGGLVRAYSK
ATKDVLDAAEVVEEVPRERFEAVVEYDDSGTIRGILESEDVEFDAAYGADVVFDISAPVA
EAEHLRDRLRSATSGRVDL
Download sequence
Identical sequences A0A1U7EUW3
348780.NP1410A WP_011322431.1.57290 gi|76801356|ref|YP_326364.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]