SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76801469|ref|YP_326477.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76801469|ref|YP_326477.1|
Domain Number 1 Region: 1-148
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 9.29e-21
Family N-acetyl transferase, NAT 0.0061
Further Details:      
 
Weak hits

Sequence:  gi|76801469|ref|YP_326477.1|
Domain Number - Region: 201-229
Classification Level Classification E-value
Superfamily RNA polymerase subunits 0.00994
Family RBP12 subunit of RNA polymerase II 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|76801469|ref|YP_326477.1|
Sequence length 240
Comment protein N-acetyltransferase-like protein [Natronomonas pharaonis DSM 2160]
Sequence
MEIREATADDGPAVRSVTLRSMEASYSLSPSTIESAIQQWYGVDNFAEKLNDDEVLLLVA
EKDGEPVAFSESALVDDRGDIHWIHVAAMHRGEGIGQAMYEETRSQLEDAGAETIRGLVL
SMNTEGNRFWENRGLQKAGEGTVEIDGTAFVENIYVDEDAVELQPVVVDGQELYIDRNDS
SRGSSGPFYTVYTDEEGENHHSYYCGSCESLVTSMDTMGRLSCEECGNQLKPTRWDAAYM
Download sequence
Identical sequences A0A1U7EV94
348780.NP1638A gi|76801469|ref|YP_326477.1| WP_011322544.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]